SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20029
         (715 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC1006.07 |||translation initiation factor eIF4A|Schizosacchar...   141   1e-34
SPAC1F5.10 |||ATP-dependent RNA helicase, eIF4A related|Schizosa...   130   1e-31
SPBC12C2.06 |||ATP-dependent RNA helicase Dbp5|Schizosaccharomyc...    62   8e-11
SPBC776.09 |ste13||ATP-dependent RNA helicase Ste13|Schizosaccha...    49   6e-07
SPCC1795.11 |sum3|ded1, slh3, moc2|ATP-dependent RNA helicase Su...    48   1e-06
SPBP8B7.16c |dbp2||ATP-dependent RNA helicase Dbp2|Schizosacchar...    45   1e-05
SPAC17G6.14c |uap56||ATP-dependent RNA helicase Uap56|Schizosacc...    43   4e-05
SPCC10H11.01 |prp11||ATP-dependent RNA helicase Prp11|Schizosacc...    42   7e-05
SPCC1494.06c |||ATP-dependent RNA helicase Dbp9 |Schizosaccharom...    39   6e-04
SPBC543.06c |dbp8||ATP-dependent RNA helicase Dbp8 |Schizosaccha...    39   8e-04
SPAC22F3.08c |rok1||ATP-dependent RNA helicase Rok1 |Schizosacch...    37   0.002
SPAC212.11 |tlh1||RecQ type DNA helicase|Schizosaccharomyces pom...    37   0.003
SPBCPT2R1.08c |tlh2||RecQ type DNA helicase Tlh1|Schizosaccharom...    37   0.003
SPCC63.11 |prp28||U5 snRNP-associated protein Prp28 |Schizosacch...    35   0.013
SPAC30D11.03 |drs1||ATP-dependent RNA helicase Drs1 |Schizosacch...    34   0.018
SPAC823.08c |||ATP-dependent RNA helicase Rrp3 |Schizosaccharomy...    32   0.094
SPCC285.03 |||ATP-dependent RNA helicase Dbp6|Schizosaccharomyce...    31   0.22 
SPBC21H7.04 |||ATP-dependent RNA helicase Dbp7 |Schizosaccharomy...    30   0.38 
SPAC31A2.07c |dbp10||ATP-dependent RNA helicase Dbp10 |Schizosac...    27   2.0  
SPAC1F7.02c |||ATP-dependent RNA helicase Has1 |Schizosaccharomy...    27   2.7  
SPBC4F6.07c |||ATP-dependent RNA helicase Mak5 |Schizosaccharomy...    27   2.7  
SPBC17D1.06 |dbp3||ATP-dependent RNA helicase Dbp3 |Schizosaccha...    27   3.5  
SPAC1786.01c ||SPAC31G5.20c|triacylglycerol lipase|Schizosacchar...    25   8.1  
SPAC688.08 |srb8|med12|mediator complex subunit Srb8 |Schizosacc...    25   8.1  

>SPAC1006.07 |||translation initiation factor
           eIF4A|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 392

 Score =  141 bits (341), Expect = 1e-34
 Identities = 59/82 (71%), Positives = 74/82 (90%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           +FY+A+E EEWKL+TLCDLY+T+++ QAVIFCNTRRKVDWLTE +  RDFTVS+MHGDMD
Sbjct: 234 QFYVAVEKEEWKLDTLCDLYETVTVTQAVIFCNTRRKVDWLTEQLTERDFTVSSMHGDMD 293

Query: 188 QREREVIMRQFRTGSSRVLITT 253
           Q +R+ +M +FRTGSSR+LITT
Sbjct: 294 QAQRDTLMHEFRTGSSRILITT 315



 Score = 84.2 bits (199), Expect = 2e-17
 Identities = 42/76 (55%), Positives = 50/76 (65%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDF 435
           LLARGIDVQQVS VINYDLP+NRENY                 NFVT  D R +++IE F
Sbjct: 317 LLARGIDVQQVSLVINYDLPANRENYIHRIGRGGRFGRKGVSINFVTNDDVRMMREIEQF 376

Query: 436 YHTSIVEMPSDVANLI 483
           Y+T I EMP ++A+LI
Sbjct: 377 YNTHIEEMPMNIADLI 392


>SPAC1F5.10 |||ATP-dependent RNA helicase, eIF4A
           related|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 394

 Score =  130 bits (315), Expect = 1e-31
 Identities = 56/85 (65%), Positives = 71/85 (83%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           +++IA+E EEWK +TLCDLYDTL+I QAVIFCN+RRKVDWLTE M   +FTV++MHG+M 
Sbjct: 236 QYFIAVEKEEWKFDTLCDLYDTLTITQAVIFCNSRRKVDWLTEKMREANFTVTSMHGEMP 295

Query: 188 QREREVIMRQFRTGSSRVLITTVYW 262
           Q+ER+ IM+ FR G+SRVLI T  W
Sbjct: 296 QKERDAIMQDFRQGNSRVLICTDIW 320



 Score = 78.2 bits (184), Expect = 1e-15
 Identities = 38/74 (51%), Positives = 46/74 (62%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARGIDVQQVS VINYDLP+NRENY                 NFVT  D R L+DIE +Y 
Sbjct: 321 ARGIDVQQVSLVINYDLPANRENYIHRIGRSGRFGRKGVAINFVTNEDVRILRDIEQYYS 380

Query: 442 TSIVEMPSDVANLI 483
           T I EMP ++ +++
Sbjct: 381 TVIDEMPMNIGDMV 394


>SPBC12C2.06 |||ATP-dependent RNA helicase Dbp5|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 503

 Score = 62.1 bits (144), Expect = 8e-11
 Identities = 28/82 (34%), Positives = 48/82 (58%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           + Y+  + EE K   L +LY  L+I Q++IFC  +   + +   M     TV+ + G+++
Sbjct: 328 QLYMDCQSEEHKYNVLVELYGLLTIGQSIIFCKKKDTAEEIARRMTADGHTVACLTGNLE 387

Query: 188 QREREVIMRQFRTGSSRVLITT 253
             +R+ IM  FR G+S+VL+TT
Sbjct: 388 GAQRDAIMDSFRVGTSKVLVTT 409



 Score = 35.9 bits (79), Expect = 0.006
 Identities = 21/78 (26%), Positives = 37/78 (47%), Gaps = 7/78 (8%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNR------ENYXXXXXXXXXXXXXXXXXNFVTEADR-RA 414
           ++ARGIDV QV+ V+NYD+P ++      + Y                 NFV +      
Sbjct: 411 VIARGIDVSQVNLVVNYDMPLDQAGRPDPQTYLHRIGRTGRFGRVGVSINFVHDKKSWEE 470

Query: 415 LKDIEDFYHTSIVEMPSD 468
           +  I++++   I  +P+D
Sbjct: 471 MNAIQEYFQRPITRVPTD 488


>SPBC776.09 |ste13||ATP-dependent RNA helicase
           Ste13|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 485

 Score = 49.2 bits (112), Expect = 6e-07
 Identities = 29/83 (34%), Positives = 40/83 (48%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDF 435
           LL RGID+Q V+ VIN+D P N E Y                 +F++ ADR  L  IE+ 
Sbjct: 340 LLTRGIDIQAVNVVINFDFPKNAETYLHRIGRSGRFGHRGLAISFISWADRFNLYRIENE 399

Query: 436 YHTSIVEMPSDVANLI*GAYIFP 504
             T I  +P  +   +   Y+FP
Sbjct: 400 LGTEIQPIPPSIDPSL---YVFP 419



 Score = 45.6 bits (103), Expect = 7e-06
 Identities = 24/81 (29%), Positives = 41/81 (50%)
 Frame = +2

Query: 5   TRFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDM 184
           T++Y  ++ E  K+  L  L+  L I Q++IFCN+  +V+ L + +    ++    H  M
Sbjct: 257 TQYYAFVD-ESQKVHCLNTLFSKLQINQSIIFCNSTNRVELLAKKITELGYSCFYSHAKM 315

Query: 185 DQREREVIMRQFRTGSSRVLI 247
            Q  R  +   FR G  R L+
Sbjct: 316 LQSHRNRVFHNFRNGVCRNLV 336


>SPCC1795.11 |sum3|ded1, slh3, moc2|ATP-dependent RNA helicase
           Sum3|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 636

 Score = 48.4 bits (110), Expect = 1e-06
 Identities = 28/84 (33%), Positives = 46/84 (54%), Gaps = 1/84 (1%)
 Frame = +2

Query: 5   TRFYIAIELEEWKLETLCDLYDTLSI-AQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGD 181
           T+  + +E  E K   L D+  TL      +IF  T+R  D LT+ +   +F  +++HGD
Sbjct: 405 TQKVVHVEDSE-KRSYLLDILHTLPPEGLTLIFVETKRMADTLTDYLLNSNFPATSIHGD 463

Query: 182 MDQREREVIMRQFRTGSSRVLITT 253
             QRERE  +  FR+G + +++ T
Sbjct: 464 RTQRERERALELFRSGRTSIMVAT 487



 Score = 32.7 bits (71), Expect = 0.054
 Identities = 12/24 (50%), Positives = 20/24 (83%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           +RG+D+  V+ VINYDLP++ ++Y
Sbjct: 491 SRGLDIPNVTHVINYDLPTDIDDY 514


>SPBP8B7.16c |dbp2||ATP-dependent RNA helicase
           Dbp2|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 550

 Score = 44.8 bits (101), Expect = 1e-05
 Identities = 19/56 (33%), Positives = 33/56 (58%)
 Frame = +2

Query: 86  QAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           + +IF  T+R  D +T  +    +   A+HGD  Q ER+ ++ +FRTG S +++ T
Sbjct: 371 KVLIFTGTKRVADDITRFLRQDGWPALAIHGDKAQDERDWVLNEFRTGKSPIMVAT 426



 Score = 33.9 bits (74), Expect = 0.023
 Identities = 13/24 (54%), Positives = 18/24 (75%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           +RGIDV+ ++ V NYD P N E+Y
Sbjct: 430 SRGIDVKGITHVFNYDFPGNTEDY 453


>SPAC17G6.14c |uap56||ATP-dependent RNA helicase
           Uap56|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 434

 Score = 43.2 bits (97), Expect = 4e-05
 Identities = 20/73 (27%), Positives = 38/73 (52%), Gaps = 1/73 (1%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNF-VTEADRRALKDIED 432
           +  RGID+++V+ VINYD+P + ++Y                  F  +E D + L  I++
Sbjct: 354 VFGRGIDIERVNIVINYDMPDSPDSYLHRVGRAGRFGTKGLAITFSSSEEDSQILDKIQE 413

Query: 433 FYHTSIVEMPSDV 471
            +  +I E+P ++
Sbjct: 414 RFEVNITELPDEI 426



 Score = 36.7 bits (81), Expect = 0.003
 Identities = 22/80 (27%), Positives = 38/80 (47%)
 Frame = +2

Query: 14  YIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQR 193
           Y+ +E E+ K   + DL D+L   Q VIF  +  + + L   +   +F    +HG + Q 
Sbjct: 274 YVKLE-EKAKNRKINDLLDSLEFNQVVIFVKSVSRANELDRLLRECNFPSICIHGGLPQE 332

Query: 194 EREVIMRQFRTGSSRVLITT 253
           ER    + F+    R+ + T
Sbjct: 333 ERIKRYKAFKDFDKRICVAT 352


>SPCC10H11.01 |prp11||ATP-dependent RNA helicase
           Prp11|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 1014

 Score = 42.3 bits (95), Expect = 7e-05
 Identities = 20/70 (28%), Positives = 37/70 (52%)
 Frame = +2

Query: 44  LETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFR 223
           LE L +LY+     + ++F + +   D L   +  R +T +++HG  DQ +R+  +  ++
Sbjct: 656 LELLGELYNNQLDVRTLVFVDRQESADALLSDLMKRGYTSNSIHGGKDQHDRDSTISDYK 715

Query: 224 TGSSRVLITT 253
            G   VLI T
Sbjct: 716 AGVFDVLIAT 725



 Score = 38.3 bits (85), Expect = 0.001
 Identities = 21/84 (25%), Positives = 36/84 (42%)
 Frame = +1

Query: 229 LFSCLDHHCLLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADR 408
           +F  L    ++ARG+DV+ +  V+NYD P++ E+Y                  F+T    
Sbjct: 718 VFDVLIATSVVARGLDVKSLQLVVNYDCPNHMEDYVHRVGRTGRAGHTGVAVTFITPEQE 777

Query: 409 RALKDIEDFYHTSIVEMPSDVANL 480
           +   DI      S   +P ++  L
Sbjct: 778 KYAVDIAKALKMSKQPVPKELQTL 801


>SPCC1494.06c |||ATP-dependent RNA helicase Dbp9
           |Schizosaccharomyces pombe|chr 3|||Manual
          Length = 595

 Score = 39.1 bits (87), Expect = 6e-04
 Identities = 13/25 (52%), Positives = 22/25 (88%)
 Frame = +1

Query: 259 LARGIDVQQVSCVINYDLPSNRENY 333
           +ARG+D + V+CV+N+D+PSN ++Y
Sbjct: 386 VARGLDFENVACVLNFDMPSNTKSY 410


>SPBC543.06c |dbp8||ATP-dependent RNA helicase Dbp8
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 453

 Score = 38.7 bits (86), Expect = 8e-04
 Identities = 17/55 (30%), Positives = 32/55 (58%)
 Frame = +2

Query: 89  AVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           A+IF N  R  + +   + L +  V+ +H +M QRER   + +FR  ++++L+ T
Sbjct: 261 AIIFVNRTRTAELIYSILRLLELRVTELHSEMVQRERINSLGRFRAEAAKILVAT 315



 Score = 36.7 bits (81), Expect = 0.003
 Identities = 20/65 (30%), Positives = 30/65 (46%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           +RG+D+  V  VIN+DLP + ++Y                 + VTE D   +  IED   
Sbjct: 319 SRGLDIPSVQLVINFDLPRDPDDYIHRVGRTARAGRSGESISIVTERDVDLVHAIEDRVG 378

Query: 442 TSIVE 456
           T + E
Sbjct: 379 TKLSE 383


>SPAC22F3.08c |rok1||ATP-dependent RNA helicase Rok1
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 481

 Score = 37.1 bits (82), Expect = 0.002
 Identities = 24/75 (32%), Positives = 32/75 (42%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDF 435
           LLARGID   V  VIN+D P +  +Y                  F T+ D   +K I   
Sbjct: 347 LLARGIDFHGVKMVINFDFPQSVHSYIHRIGRTGRAGNTGQAVTFFTKEDGEYIKLIAGV 406

Query: 436 YHTSIVEMPSDVANL 480
             +S  E+P+ V  L
Sbjct: 407 MRSSGCEVPNWVMAL 421



 Score = 32.3 bits (70), Expect = 0.071
 Identities = 17/56 (30%), Positives = 27/56 (48%)
 Frame = +2

Query: 86  QAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           + VIF     +   L   +   +  V  +HG++ Q +RE  + +FR G   VLI T
Sbjct: 290 RVVIFVQDIERAKALYTELLFDEIHVGVIHGELPQAKREEALAKFRKGEIWVLIAT 345


>SPAC212.11 |tlh1||RecQ type DNA helicase|Schizosaccharomyces
            pombe|chr 1||Partial|Manual
          Length = 1887

 Score = 36.7 bits (81), Expect = 0.003
 Identities = 19/62 (30%), Positives = 34/62 (54%), Gaps = 6/62 (9%)
 Frame = +2

Query: 86   QAVIFCNTRRKVDWLTESMHLRDF----TVSAMHGDMDQREREVIMRQFR--TGSSRVLI 247
            +A+IFC T++ V+++   +H  D      V+   GD+   ER++    FR   G +R++I
Sbjct: 1417 RAIIFCRTKKDVEYIHRRLHQSDLFAHTHVTIYTGDVSDEERQMNFDAFRNANGKTRIMI 1476

Query: 248  TT 253
             T
Sbjct: 1477 AT 1478


>SPBCPT2R1.08c |tlh2||RecQ type DNA helicase Tlh1|Schizosaccharomyces
            pombe|chr 2|||Manual
          Length = 1919

 Score = 36.7 bits (81), Expect = 0.003
 Identities = 19/62 (30%), Positives = 34/62 (54%), Gaps = 6/62 (9%)
 Frame = +2

Query: 86   QAVIFCNTRRKVDWLTESMHLRDF----TVSAMHGDMDQREREVIMRQFR--TGSSRVLI 247
            +A+IFC T++ V+++   +H  D      V+   GD+   ER++    FR   G +R++I
Sbjct: 1417 RAIIFCRTKKDVEYIHRRLHQSDLFAHTHVTIYTGDVSDEERQMNFDAFRNANGKTRIMI 1476

Query: 248  TT 253
             T
Sbjct: 1477 AT 1478


>SPCC63.11 |prp28||U5 snRNP-associated protein Prp28
           |Schizosaccharomyces pombe|chr 3|||Manual
          Length = 662

 Score = 34.7 bits (76), Expect = 0.013
 Identities = 13/54 (24%), Positives = 29/54 (53%)
 Frame = +2

Query: 92  VIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           +IF N +R ++ + + ++   +    +HG   Q +RE  + Q R  ++ +L+ T
Sbjct: 520 IIFVNLKRNIEAIAKQLNAIGWHAVTLHGSKSQEQRERAIEQLRNKTADILVAT 573



 Score = 29.5 bits (63), Expect = 0.50
 Identities = 11/26 (42%), Positives = 18/26 (69%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENY 333
           +  RGID+  VS V+NY++  + E+Y
Sbjct: 575 IAGRGIDIPNVSLVLNYNMAKSIEDY 600


>SPAC30D11.03 |drs1||ATP-dependent RNA helicase Drs1
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 754

 Score = 34.3 bits (75), Expect = 0.018
 Identities = 16/55 (29%), Positives = 24/55 (43%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDI 426
           +RGID++ +  VINY+ P+  E Y                     E DR+ LK +
Sbjct: 565 SRGIDIKGIEVVINYEAPATHEVYLHRVGRTARAGRSGRAITLAGEGDRKVLKGV 619



 Score = 25.8 bits (54), Expect = 6.1
 Identities = 12/56 (21%), Positives = 23/56 (41%)
 Frame = +2

Query: 86  QAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           + +IF  ++     +     L     + +HG + Q +R   +  FR G    L+ T
Sbjct: 506 RTIIFFRSKAFAHKMRVIFGLLSLNATEIHGSLSQEQRVRALEDFRDGKCNYLLAT 561


>SPAC823.08c |||ATP-dependent RNA helicase Rrp3 |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 465

 Score = 31.9 bits (69), Expect = 0.094
 Identities = 12/24 (50%), Positives = 18/24 (75%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           ARG+D+  V  VINYD+P++ + Y
Sbjct: 346 ARGLDIPLVDVVINYDIPTDSKAY 369



 Score = 29.1 bits (62), Expect = 0.66
 Identities = 15/64 (23%), Positives = 28/64 (43%)
 Frame = +2

Query: 62  LYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRV 241
           L + L+    +IF  T      L   +    F+   +HG + Q  R   + +F++G+   
Sbjct: 279 LVNELAGNSIIIFARTVNDTQRLAILLRTLGFSAIPLHGQLSQSNRLGALNKFKSGARST 338

Query: 242 LITT 253
           L+ T
Sbjct: 339 LVAT 342


>SPCC285.03 |||ATP-dependent RNA helicase Dbp6|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 604

 Score = 30.7 bits (66), Expect = 0.22
 Identities = 14/26 (53%), Positives = 17/26 (65%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENY 333
           L+ARGIDV     VINYD P +  +Y
Sbjct: 496 LMARGIDVANTQNVINYDPPLSVRSY 521


>SPBC21H7.04 |||ATP-dependent RNA helicase Dbp7 |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 709

 Score = 29.9 bits (64), Expect = 0.38
 Identities = 15/74 (20%), Positives = 31/74 (41%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARG+D+  V  V+ YD P + ++Y                  F+   +   +  ++    
Sbjct: 507 ARGLDLPNVDLVVQYDAPFSTDDYLHRIGRTARAGHNGAAIMFLLPKESEYINLLKSSVS 566

Query: 442 TSIVEMPSDVANLI 483
            +I+E P+  + L+
Sbjct: 567 ANILEQPNGPSGLL 580


>SPAC31A2.07c |dbp10||ATP-dependent RNA helicase Dbp10
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 848

 Score = 27.5 bits (58), Expect = 2.0
 Identities = 17/70 (24%), Positives = 28/70 (40%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           +RGID+  ++ VINYD P   + +                 + V   D   L D++ F +
Sbjct: 407 SRGIDIPLLANVINYDFPPQPKVFVHRVGRTARAGRTGWAYSLVRAEDAGYLLDLQLFLN 466

Query: 442 TSIVEMPSDV 471
             +V     V
Sbjct: 467 RPLVTSSKQV 476


>SPAC1F7.02c |||ATP-dependent RNA helicase Has1 |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 578

 Score = 27.1 bits (57), Expect = 2.7
 Identities = 12/56 (21%), Positives = 26/56 (46%)
 Frame = +2

Query: 86  QAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           + ++F ++   V ++ E ++  D  V  +HG   Q+ R     +F      +L+ T
Sbjct: 338 KVIVFMSSCASVKYMAELLNYIDLPVLDLHGKQKQQRRTNTFFEFCNAEKGILLCT 393



 Score = 26.6 bits (56), Expect = 3.5
 Identities = 9/24 (37%), Positives = 15/24 (62%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           ARG+D+  V  ++ YD P +  +Y
Sbjct: 397 ARGLDIPAVDWIVQYDPPDDPRDY 420


>SPBC4F6.07c |||ATP-dependent RNA helicase Mak5 |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 648

 Score = 27.1 bits (57), Expect = 2.7
 Identities = 11/24 (45%), Positives = 16/24 (66%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           ARGID+  V+ VI+Y +P   + Y
Sbjct: 450 ARGIDIPSVTHVIHYHVPHTADMY 473


>SPBC17D1.06 |dbp3||ATP-dependent RNA helicase Dbp3
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 578

 Score = 26.6 bits (56), Expect = 3.5
 Identities = 11/24 (45%), Positives = 15/24 (62%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           ARG+D+ +V  VIN   P   E+Y
Sbjct: 477 ARGLDIPKVQLVINVTFPLTIEDY 500


>SPAC1786.01c ||SPAC31G5.20c|triacylglycerol
           lipase|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 630

 Score = 25.4 bits (53), Expect = 8.1
 Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 2/34 (5%)
 Frame = +2

Query: 32  EEWKLETLCDLYDTLSIAQAVI--FCNTRRKVDW 127
           +EWKL+ + D YD  ++ QAV       R + DW
Sbjct: 143 DEWKLDPVYDYYD-YTLVQAVYSSLVKHREQKDW 175


>SPAC688.08 |srb8|med12|mediator complex subunit Srb8
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1233

 Score = 25.4 bits (53), Expect = 8.1
 Identities = 16/54 (29%), Positives = 28/54 (51%)
 Frame = -1

Query: 205 HFTLTLIHVSMHSRYSKVTQMHRFSEPIHLATGVAENYSLCNRQCIIQVTQSFQ 44
           HF L ++  S  S   K   +H F+     +T + +   +C R+C+I + QS+Q
Sbjct: 256 HFLLRIVSFSGDSSL-KSFSLHFFALQF-FSTSLIQYTHIC-RKCVITILQSYQ 306


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,863,624
Number of Sequences: 5004
Number of extensions: 57767
Number of successful extensions: 161
Number of sequences better than 10.0: 24
Number of HSP's better than 10.0 without gapping: 141
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 159
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 333194204
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -