SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20008
         (705 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC29A3.04 |rpl8||60S ribosomal protein L7a |Schizosaccharomyce...    76   6e-15
SPAC607.03c |snu13||U3 snoRNP-associated protein Snu13|Schizosac...    30   0.28 
SPAC1782.10c |nhp2||RNA-binding protein Nhp2 |Schizosaccharomyce...    29   0.65 
SPAC6F12.12 |par2|pbp2|protein phosphatase regulatory subunit Pa...    26   6.0  
SPCC16C4.07 |scw1||RNA-binding protein Scw1|Schizosaccharomyces ...    25   8.0  
SPCC24B10.15 |||PINc domain|Schizosaccharomyces pombe|chr 3|||Ma...    25   8.0  

>SPBC29A3.04 |rpl8||60S ribosomal protein L7a |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 259

 Score = 75.8 bits (178), Expect = 6e-15
 Identities = 35/66 (53%), Positives = 46/66 (69%)
 Frame = +2

Query: 506 HVTKLVEKKKAQLWSSLMMLIPLSWFLFLPALCRKMGVPYCIVKGKSRLGALVHRKTCTC 685
           HV  L+E KKA+L      + P+   +FLPALC+KMGVPY IVK K+RLG ++H+KT   
Sbjct: 138 HVVALIEAKKAKLVLIASDVDPIELVVFLPALCKKMGVPYAIVKNKARLGTVIHQKTAAV 197

Query: 686 LALTNV 703
           LA+T V
Sbjct: 198 LAVTEV 203



 Score = 72.9 bits (171), Expect = 4e-14
 Identities = 33/56 (58%), Positives = 42/56 (75%)
 Frame = +3

Query: 234 LVQICKMPKYIRIQRQKAVLQRRLKVPPPINQFTQTLDKTTAKGLFKILEKYRPET 401
           L +  K P+YIR+QR++ +L  RLKVPP I QF +TLDK TA  +FK+L KYRPET
Sbjct: 46  LSRFVKWPEYIRLQRRRKILNLRLKVPPAIAQFQKTLDKNTATQVFKLLNKYRPET 101



 Score = 51.6 bits (118), Expect = 1e-07
 Identities = 25/49 (51%), Positives = 30/49 (61%)
 Frame = +1

Query: 169 NPLFEKRPKNFAIGQGIQPTRDLSRFVRCPSISASSARRLYFSVV*KCP 315
           NPLF  RP++F IGQ IQP RDLSRFV+ P       RR   ++  K P
Sbjct: 24  NPLFVSRPRSFGIGQDIQPKRDLSRFVKWPEYIRLQRRRKILNLRLKVP 72


>SPAC607.03c |snu13||U3 snoRNP-associated protein
           Snu13|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 125

 Score = 30.3 bits (65), Expect = 0.28
 Identities = 13/29 (44%), Positives = 15/29 (51%)
 Frame = +2

Query: 569 PLSWFLFLPALCRKMGVPYCIVKGKSRLG 655
           P+   L LP LC    VPY  V  K+ LG
Sbjct: 59  PIEILLHLPLLCEDKNVPYVFVPSKAALG 87


>SPAC1782.10c |nhp2||RNA-binding protein Nhp2 |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 154

 Score = 29.1 bits (62), Expect = 0.65
 Identities = 21/68 (30%), Positives = 27/68 (39%), Gaps = 1/68 (1%)
 Frame = +2

Query: 482 QHHPIRH-KHVTKLVEKKKAQLWSSLMMLIPLSWFLFLPALCRKMGVPYCIVKGKSRLGA 658
           Q H +R  K V K V K +  L      + P+     +P LC    VPY     K  LG 
Sbjct: 51  QKHILRGVKEVVKAVRKGEKGLVILAGDISPMDVISHIPVLCEDNNVPYLYTVSKELLGE 110

Query: 659 LVHRKTCT 682
             + K  T
Sbjct: 111 ASNTKRPT 118


>SPAC6F12.12 |par2|pbp2|protein phosphatase regulatory subunit
           Par2|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 627

 Score = 25.8 bits (54), Expect = 6.0
 Identities = 14/34 (41%), Positives = 19/34 (55%)
 Frame = +3

Query: 282 KAVLQRRLKVPPPINQFTQTLDKTTAKGLFKILE 383
           KAVL   LK  P IN F + L     + +F++LE
Sbjct: 463 KAVLTGILKYWPRINSFKELLFLNEIEDIFEVLE 496


>SPCC16C4.07 |scw1||RNA-binding protein Scw1|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 561

 Score = 25.4 bits (53), Expect = 8.0
 Identities = 12/30 (40%), Positives = 16/30 (53%)
 Frame = +2

Query: 266 PHPAPEGCTSASSESAPSDQPIYPDTGQDY 355
           PHP      SA S ++P   P+ P T +DY
Sbjct: 355 PHPRVFSANSAFSTTSPP--PLTPSTSRDY 382


>SPCC24B10.15 |||PINc domain|Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 462

 Score = 25.4 bits (53), Expect = 8.0
 Identities = 16/57 (28%), Positives = 24/57 (42%)
 Frame = -2

Query: 464 LIFLGNLSFSSFPQPLFPGCFSLRPVFLQNLEKALSCSLVQCLGKLVDRRGHFQTTL 294
           L F   L  +S  Q  FP  FS     L+NL   +  ++ Q L    + R    +T+
Sbjct: 197 LSFSKGLEAASIVQTSFPSAFSSNSENLENLSMDIDLTVSQPLATATNHRNQGASTV 253


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,680,465
Number of Sequences: 5004
Number of extensions: 50809
Number of successful extensions: 169
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 163
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 168
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 327172622
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -