SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30156.Seq
         (961 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPCC576.08c |rps2||40S ribosomal protein S2|Schizosaccharomyces ...   144   1e-35
SPBC1A4.07c |||U3 snoRNP-associated protein Sof1|Schizosaccharom...    28   1.7  
SPAC16E8.01 |||cytoskeletal protein binding protein Sla1 family ...    28   2.2  
SPAC637.05c |vma2||V-type ATPase V1 subunit B |Schizosaccharomyc...    26   6.9  

>SPCC576.08c |rps2||40S ribosomal protein S2|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 253

 Score =  144 bits (350), Expect = 1e-35
 Identities = 67/110 (60%), Positives = 87/110 (79%)
 Frame = +1

Query: 220 KNRQTREHLLVFLPIKEFEIIDFFLGPSLNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDN 399
           K +   E  L  LPIKE++I+D+FL P LNDEV+K++PVQKQTRAGQRTRFKAFV IGD+
Sbjct: 48  KIKSIEEIYLYSLPIKEYQIVDYFL-PRLNDEVMKVVPVQKQTRAGQRTRFKAFVVIGDS 106

Query: 400 NGHIGLGVKCSKEVATAIRGAIILAKLSVLTSPKKLRGNKIGKPHNRPLQ 549
           +GH+GLG+KC+KEVATAIRGAII+ KLS++   +   G  +G PH  P++
Sbjct: 107 DGHVGLGIKCAKEVATAIRGAIIMGKLSIMPIRRGYWGTALGDPHTVPVK 156



 Score = 51.2 bits (117), Expect = 2e-07
 Identities = 20/31 (64%), Positives = 27/31 (87%)
 Frame = +2

Query: 161 KEDQKEWVPVTKLGRLVREGKIDKLESIYLF 253
           ++++KEWVPVTKLGRLV+ GKI  +E IYL+
Sbjct: 28  RDEEKEWVPVTKLGRLVKAGKIKSIEEIYLY 58


>SPBC1A4.07c |||U3 snoRNP-associated protein
           Sof1|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 436

 Score = 28.3 bits (60), Expect = 1.7
 Identities = 12/37 (32%), Positives = 22/37 (59%)
 Frame = +2

Query: 269 NSRSLISSSARP*MMRFLRSCLYRNKHVPDSAHVSRH 379
           +SR+ I S+     +++L S   R KH+P+   ++RH
Sbjct: 348 SSRASIRSTREENRLKYLDSLRERYKHIPEIRRIARH 384


>SPAC16E8.01 |||cytoskeletal protein binding protein Sla1 family
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1420

 Score = 27.9 bits (59), Expect = 2.2
 Identities = 13/42 (30%), Positives = 21/42 (50%)
 Frame = -3

Query: 158 RAHDHGRDHDRVHEDRHGLYLHRVIRIRRENRHVHRLEQRPP 33
           ++HDHG  H + H DR      +  R  R++R     ++ PP
Sbjct: 720 QSHDHGHSHSKSH-DREKEKEKKKDREHRKHRETEEEDEGPP 760


>SPAC637.05c |vma2||V-type ATPase V1 subunit B |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 503

 Score = 26.2 bits (55), Expect = 6.9
 Identities = 15/45 (33%), Positives = 25/45 (55%), Gaps = 2/45 (4%)
 Frame = -3

Query: 503 FFGLVRTDSLARIIAPRMAVATS--LLHFTPKPI*PLLSPMATNA 375
           F  L    ++ RII PR+A++ S  L + T K +  +L+ M + A
Sbjct: 238 FLNLANDPTIERIITPRLALSASEFLAYQTEKHVLTILTDMTSYA 282


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,374,238
Number of Sequences: 5004
Number of extensions: 65092
Number of successful extensions: 150
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 143
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 149
length of database: 2,362,478
effective HSP length: 73
effective length of database: 1,997,186
effective search space used: 491307756
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -