SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30152.Seq
         (877 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC83.03c |tas3||RITS complex subunit 3 |Schizosaccharomyces po...    29   1.1  
SPAC23D3.08 |usp108||U1 snRNP-associated protein Usp108|Schizosa...    26   8.1  

>SPBC83.03c |tas3||RITS complex subunit 3 |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 549

 Score = 28.7 bits (61), Expect = 1.1
 Identities = 17/66 (25%), Positives = 33/66 (50%), Gaps = 2/66 (3%)
 Frame = -3

Query: 692 PVASEGIRRSVL-RLLQSNAINTFVHPLRVCNRKHALQKS*FQDSFLGSMNF*D-DRNKA 519
           P+ ++G  + V  + L+ N++  F  P+     KH   ++ F D   GSM     D + +
Sbjct: 122 PLVTDGKEKPVKSKQLRKNSVTEFEKPIETKKSKHRKSRNKFLDKSSGSMEIESWDNSTS 181

Query: 518 EALQES 501
           +++ ES
Sbjct: 182 DSIIES 187


>SPAC23D3.08 |usp108||U1 snRNP-associated protein
           Usp108|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 382

 Score = 25.8 bits (54), Expect = 8.1
 Identities = 10/35 (28%), Positives = 16/35 (45%)
 Frame = +3

Query: 771 LGQLTIPDGPIGSTPVKINWAAFELGDCSTTQIFP 875
           +  +  P+ P G  P+ +  A        TTQ+FP
Sbjct: 214 MSSMVTPENPYGIPPIALTSAGGNPDPLRTTQVFP 248


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,482,237
Number of Sequences: 5004
Number of extensions: 70325
Number of successful extensions: 154
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 150
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 154
length of database: 2,362,478
effective HSP length: 72
effective length of database: 2,002,190
effective search space used: 438479610
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -