SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30115.Seq
         (690 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC1565.08 |cdc48|SPAC6F12.01|AAA family ATPase Cdc48|Schizosac...   100   2e-22
SPAC5D6.01 |rps2202|rps22-2, rps15a-2|40S ribosomal protein S15a...    29   0.84 
SPCC285.10c |||SPRY domain protein|Schizosaccharomyces pombe|chr...    29   0.84 
SPAC22A12.04c |rps2201|rps22-1, rps15a-1|40S ribosomal protein S...    29   0.84 
SPCC1235.09 |||histone deacetylase complex subunit|Schizosacchar...    29   0.84 
SPAC4D7.02c |||glycerophosphoryl diester phosphodiesterase |Schi...    28   1.1  
SPAC12G12.01c ||SPAC630.02|ubiquitin-protein ligase E3|Schizosac...    28   1.5  
SPBP4G3.03 |||PI31 proteasome regulator related|Schizosaccharomy...    27   1.9  
SPAC1556.02c |sdh1||succinate dehydrogenase Sdh1|Schizosaccharom...    27   3.4  
SPAPJ698.02c |rps002|rpsa-2, rps0-2, rps0|40S ribosomal protein ...    27   3.4  
SPBC685.03 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||...    26   4.5  
SPBC428.15 |||GTP binding protein|Schizosaccharomyces pombe|chr ...    26   5.9  
SPCC645.06c |rgf3|lad1|RhoGEF Rgf3|Schizosaccharomyces pombe|chr...    26   5.9  
SPCC23B6.04c |||sec14 cytosolic factor family|Schizosaccharomyce...    25   7.8  

>SPAC1565.08 |cdc48|SPAC6F12.01|AAA family ATPase
           Cdc48|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 815

 Score =  100 bits (239), Expect = 2e-22
 Identities = 44/100 (44%), Positives = 66/100 (66%)
 Frame = +2

Query: 215 LAQGQTPQGNRLHLLSDDNCPDEKIRMXXXXXXXXXXXXSDVVSIAPCPSVKYGKRVHIL 394
           + +G+  +   L +L+D+   D   R+             D+V+I PCP +KY +R+ +L
Sbjct: 78  VVKGKRRKDTVLIVLTDEEMEDGVARINRVVRNNLRVRLGDIVTINPCPDIKYAERISVL 137

Query: 395 PIDDSVEGLTGNLFEVYLKPYFMEAYRPIHRDDTFMVRGA 514
           P+ D+VEGLTG+LF+VYLKPYF+EAYRPI + D F+VRG+
Sbjct: 138 PLADTVEGLTGSLFDVYLKPYFVEAYRPIRKGDLFVVRGS 177



 Score = 89.8 bits (213), Expect = 3e-19
 Identities = 42/70 (60%), Positives = 54/70 (77%)
 Frame = +3

Query: 45  NKMADNKSPDDLSTAILRRKDRPNRLIVEEAVSDDNSVVALSQAKMEQLQLFRGDTVLLK 224
           N   D  S +D +TAILR+K +PN L+V++A +DDNSV+ LS   ME LQLFRGDTV++K
Sbjct: 21  NPPKDTYSAEDTATAILRKKRKPNSLVVDDATNDDNSVITLSSNTMETLQLFRGDTVVVK 80

Query: 225 GKRRKETVCI 254
           GKRRK+TV I
Sbjct: 81  GKRRKDTVLI 90



 Score = 82.2 bits (194), Expect = 6e-17
 Identities = 36/56 (64%), Positives = 44/56 (78%)
 Frame = +1

Query: 514 MRAVEFKVVETDPSPFCIVAPDTVIHCDGEPIKREEEEEALNAVGYDDIGGCRKQL 681
           MR VEFKVV+  P  F IV+ DT+IH +GEPI RE+EE +L  VGYDDIGGCR+Q+
Sbjct: 178 MRQVEFKVVDVAPDEFGIVSQDTIIHWEGEPINREDEESSLAEVGYDDIGGCRRQM 233


>SPAC5D6.01 |rps2202|rps22-2, rps15a-2|40S ribosomal protein
           S15a|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 130

 Score = 28.7 bits (61), Expect = 0.84
 Identities = 11/27 (40%), Positives = 19/27 (70%), Gaps = 3/27 (11%)
 Frame = -2

Query: 413 QLNHQLAVCGLV---FHISLKDTERWI 342
           QLN ++  CG++   F++ LKD E+W+
Sbjct: 64  QLNGRINKCGVISPRFNVKLKDIEKWV 90


>SPCC285.10c |||SPRY domain protein|Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 382

 Score = 28.7 bits (61), Expect = 0.84
 Identities = 22/80 (27%), Positives = 38/80 (47%), Gaps = 2/80 (2%)
 Frame = +1

Query: 19  FLDSNNKF*IKWQIIKALMIYRPRSSVARTDPTVS--LSKKQSAMTTQSWHFHRPKWSNF 192
           F+++N K   KW++  A+    P  S + + PT+S   + + SA TT     +RP  S  
Sbjct: 286 FIEANIK---KWRLAPAVGSLAPPPSYSTSQPTISWDAASESSAGTTTQGDTNRPDKSKN 342

Query: 193 NSSVVTQSCSRANAARKPFA 252
            S  +    +  +AA   F+
Sbjct: 343 RSPPINFDGTSYDAAGNVFS 362


>SPAC22A12.04c |rps2201|rps22-1, rps15a-1|40S ribosomal protein
           S15a|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 130

 Score = 28.7 bits (61), Expect = 0.84
 Identities = 11/27 (40%), Positives = 19/27 (70%), Gaps = 3/27 (11%)
 Frame = -2

Query: 413 QLNHQLAVCGLV---FHISLKDTERWI 342
           QLN ++  CG++   F++ LKD E+W+
Sbjct: 64  QLNGRINKCGVISPRFNVKLKDIEKWV 90


>SPCC1235.09 |||histone deacetylase complex
           subunit|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 564

 Score = 28.7 bits (61), Expect = 0.84
 Identities = 16/49 (32%), Positives = 28/49 (57%), Gaps = 4/49 (8%)
 Frame = +3

Query: 123 IVEEAVSDDNSVVALSQA-KMEQLQLFR---GDTVLLKGKRRKETVCIC 257
           + +E  SD++ ++A++     EQ+   R    D  LL GK++KE +C C
Sbjct: 509 LFKELGSDNSELIAVTNVLPEEQVNFLRWSFDDKDLLIGKQKKEIICCC 557


>SPAC4D7.02c |||glycerophosphoryl diester phosphodiesterase
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 319

 Score = 28.3 bits (60), Expect = 1.1
 Identities = 12/39 (30%), Positives = 20/39 (51%), Gaps = 1/39 (2%)
 Frame = +1

Query: 70  LMIYRPRSSVARTDPTVSLSKKQSAMTTQSWH-FHRPKW 183
           L + R    +   DP ++ +  Q  + T+SWH FH  +W
Sbjct: 259 LALIRGCDGLLSDDPVMARALSQGPIVTKSWHYFHYSEW 297


>SPAC12G12.01c ||SPAC630.02|ubiquitin-protein ligase
           E3|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 905

 Score = 27.9 bits (59), Expect = 1.5
 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 1/38 (2%)
 Frame = -2

Query: 383 LVFHISLKDTERWIP-HQKDAHEGCFSQHGSSEFSHQG 273
           LV  + LKD   WI    + + E  F   G ++FS+QG
Sbjct: 435 LVSDLYLKDLWSWIHLSHRQSEESLFGDTGDTDFSYQG 472


>SPBP4G3.03 |||PI31 proteasome regulator related|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 241

 Score = 27.5 bits (58), Expect = 1.9
 Identities = 14/48 (29%), Positives = 21/48 (43%)
 Frame = -2

Query: 383 LVFHISLKDTERWIPHQKDAHEGCFSQHGSSEFSHQGNYRLRADANGF 240
           L FH ++ D   W PH+ +   G F  H     + +G +  R    GF
Sbjct: 177 LGFHPNVGDYFDWYPHRPNHFGGKFDGHSRGRGAGRGGFCGRHGRGGF 224


>SPAC1556.02c |sdh1||succinate dehydrogenase
           Sdh1|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 641

 Score = 26.6 bits (56), Expect = 3.4
 Identities = 17/56 (30%), Positives = 26/56 (46%), Gaps = 1/56 (1%)
 Frame = -1

Query: 540 DHFELDGAHAP-RTMKVSSRWIGR*ASMKYGFKYTSNRLPVRPSTESSIGSMWTRF 376
           DH  L  +H P   +K     I   A++  G   T   +PV P+   ++G + TRF
Sbjct: 355 DHCYLQLSHLPAEILKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTRF 410


>SPAPJ698.02c |rps002|rpsa-2, rps0-2, rps0|40S ribosomal protein
           S0B|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 287

 Score = 26.6 bits (56), Expect = 3.4
 Identities = 12/30 (40%), Positives = 18/30 (60%)
 Frame = +1

Query: 568 VAPDTVIHCDGEPIKREEEEEALNAVGYDD 657
           V PD   + D E I+REEE++A  A   ++
Sbjct: 200 VMPDLYFYRDPEEIEREEEQKAAAAAAAEE 229


>SPBC685.03 |||sequence orphan|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 452

 Score = 26.2 bits (55), Expect = 4.5
 Identities = 14/48 (29%), Positives = 26/48 (54%)
 Frame = +1

Query: 91  SSVARTDPTVSLSKKQSAMTTQSWHFHRPKWSNFNSSVVTQSCSRANA 234
           SSV       S S   ++M++ + +F+    S+ +SSV T + S +N+
Sbjct: 329 SSVVIVQSETSCSINSASMSSNTTYFYWNSTSSLSSSVFTNTTSSSNS 376


>SPBC428.15 |||GTP binding protein|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 409

 Score = 25.8 bits (54), Expect = 5.9
 Identities = 11/27 (40%), Positives = 19/27 (70%), Gaps = 1/27 (3%)
 Frame = +3

Query: 69  PD-DLSTAILRRKDRPNRLIVEEAVSD 146
           PD D + + + RK+ PNRL++  A+S+
Sbjct: 233 PDADANISKIARKEDPNRLVLASAISE 259


>SPCC645.06c |rgf3|lad1|RhoGEF Rgf3|Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 1275

 Score = 25.8 bits (54), Expect = 5.9
 Identities = 14/53 (26%), Positives = 30/53 (56%)
 Frame = +3

Query: 42  LNKMADNKSPDDLSTAILRRKDRPNRLIVEEAVSDDNSVVALSQAKMEQLQLF 200
           L  +A N   + L+T   +RK + N  ++ +A ++ N+  +++ A  E+ QL+
Sbjct: 768 LGSLAGNLPQESLTTKS-KRKSKVNLELMFDATAEKNNENSMNSAVFEKSQLY 819


>SPCC23B6.04c |||sec14 cytosolic factor family|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 1008

 Score = 25.4 bits (53), Expect = 7.8
 Identities = 10/38 (26%), Positives = 22/38 (57%)
 Frame = +3

Query: 129 EEAVSDDNSVVALSQAKMEQLQLFRGDTVLLKGKRRKE 242
           E+AV D+N+ ++L+  +  +    RGD  ++ G   ++
Sbjct: 247 EKAVCDENTKISLTNTEHYKFHSLRGDVEVVVGDLERD 284


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,846,775
Number of Sequences: 5004
Number of extensions: 58223
Number of successful extensions: 178
Number of sequences better than 10.0: 14
Number of HSP's better than 10.0 without gapping: 173
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 178
length of database: 2,362,478
effective HSP length: 70
effective length of database: 2,012,198
effective search space used: 319939482
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -