BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0039.Seq (674 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC13G1.13 |tfb2|SPBC31F10.01|transcription factor TFIIH comple... 40 2e-04 SPAC29A4.16 |hal4|sat4, ppk10|halotolerence protein 4|Schizosacc... 29 0.81 SPAC9E9.10c |cbh1|cbh|centromere binding protein |Schizosaccharo... 26 5.7 SPAC31G5.09c |spk1||MAP kinase Spk1|Schizosaccharomyces pombe|ch... 25 7.6 SPCC31H12.08c |ccr4|SPCC5E4.02c|CCR4-Not complex subunit Ccr4 |S... 25 7.6 SPCC965.04c |||mitochondrial inner membrane i-AAA protease compl... 25 7.6 SPBC2F12.03c |||EST1 family protein|Schizosaccharomyces pombe|ch... 25 10.0 >SPBC13G1.13 |tfb2|SPBC31F10.01|transcription factor TFIIH complex subunit Tfb2 |Schizosaccharomyces pombe|chr 2|||Manual Length = 447 Score = 40.3 bits (90), Expect = 2e-04 Identities = 19/53 (35%), Positives = 29/53 (54%), Gaps = 1/53 (1%) Frame = +1 Query: 508 LSFLDAYALERWECVLHYMVGNAQTEGISADAVRIMLHAGL-HDQKRKRRVRR 663 + FLDAYA E WE +LH+MVG + + + ++ GL K + R+ R Sbjct: 128 VDFLDAYAKETWETILHFMVGTPEAKFPGEGVLSLLKRGGLMSGPKNQLRITR 180 Score = 32.3 bits (70), Expect = 0.066 Identities = 14/24 (58%), Positives = 17/24 (70%) Frame = +3 Query: 180 LYNYPTICLAVYRELPELARHFVI 251 LY P CLAV+R LP LAR +V+ Sbjct: 22 LYQKPAACLAVFRLLPILARQYVM 45 >SPAC29A4.16 |hal4|sat4, ppk10|halotolerence protein 4|Schizosaccharomyces pombe|chr 1|||Manual Length = 636 Score = 28.7 bits (61), Expect = 0.81 Identities = 31/109 (28%), Positives = 47/109 (43%), Gaps = 1/109 (0%) Frame = -3 Query: 549 ALPALQRVRVQERQSRAFPSGSSDDDMLHALPPPSNDTLRFFLNDCASIQPGMPPGMGAS 370 A+ + V +Q +Q + P SS + A+PPPSN+ R S +P A+ Sbjct: 77 AVASSSNVSLQSQQPLSKPVVSSKPNQTTAMPPPSNNPSRHV--SSTSNKPAAVSPNPAA 134 Query: 369 CHTE-SSDSVVHAFACSLAYVCETQDVTTACGTGCSTNSSGLRSDVLAL 226 H E S SV + + S A T TT G +N + VL++ Sbjct: 135 HHAELPSGSVPPSASVSRANSTAT---TTPHKAGVVSNPAAANVHVLSV 180 >SPAC9E9.10c |cbh1|cbh|centromere binding protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 514 Score = 25.8 bits (54), Expect = 5.7 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = +2 Query: 275 VPQAVVTSWVSQTYAKEQAKACTTLSEL 358 +PQ VT W +TY K+ ++ +T+SE+ Sbjct: 27 IPQKEVTEWFRKTYNKDLSQ--STISEI 52 >SPAC31G5.09c |spk1||MAP kinase Spk1|Schizosaccharomyces pombe|chr 1|||Manual Length = 372 Score = 25.4 bits (53), Expect = 7.6 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +3 Query: 183 YNYPTICLAVYRELPELARHF 245 +N+P CL RE+ +L RHF Sbjct: 73 FNHPVFCLRTLREI-KLLRHF 92 >SPCC31H12.08c |ccr4|SPCC5E4.02c|CCR4-Not complex subunit Ccr4 |Schizosaccharomyces pombe|chr 3|||Manual Length = 690 Score = 25.4 bits (53), Expect = 7.6 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +2 Query: 386 GGMPGWMLAQSFKKNLKVSLLGGGRA 463 G P W L+ S++K+L + LGG A Sbjct: 355 GYTPSWALSWSYRKDLIMQELGGYNA 380 >SPCC965.04c |||mitochondrial inner membrane i-AAA protease complex subunit Yme1 |Schizosaccharomyces pombe|chr 3|||Manual Length = 709 Score = 25.4 bits (53), Expect = 7.6 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = -1 Query: 404 SSPACPPVWAPPATRRAL 351 S+P PPVWAP AL Sbjct: 177 STPTPPPVWAPTIVSSAL 194 >SPBC2F12.03c |||EST1 family protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 891 Score = 25.0 bits (52), Expect = 10.0 Identities = 12/47 (25%), Positives = 23/47 (48%) Frame = +2 Query: 197 YMSRCISRITRASTSLRNPLLFVEQPVPQAVVTSWVSQTYAKEQAKA 337 Y +C+S +T TS P +E P+ + +W + T ++ + A Sbjct: 194 YHLQCLSPLTSFFTSCVTPKTILESPLRKQGSHNWKTSTNSQSRLAA 240 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,469,205 Number of Sequences: 5004 Number of extensions: 48458 Number of successful extensions: 144 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 141 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 144 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 309878492 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -