SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A17
         (656 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC1F7.13c |rpl801|rpl8-1, rpl18, rpk5a, rpl2-1, SPAC21E11.02c|...   283   2e-77
SPBC2F12.07c |rpl802|rpl8-2, rpk37, rpk5b|60S ribosomal protein ...   283   2e-77
SPBC839.04 |rpl803|rpl8-3, rpk5-b, rpkD4|60S ribosomal protein L...   283   2e-77
SPCC16C4.15 |rml2||mitochondrial ribosomal protein subunit L2|Sc...    42   6e-05
SPBC1198.04c |zas1||zinc finger protein Zas1|Schizosaccharomyces...    30   0.26 
SPAC1F12.10c |||NADPH-hemoprotein reductase |Schizosaccharomyces...    27   2.4  
SPAC23D3.10c |eng2||endo-1,3-beta-glucanase Eng2|Schizosaccharom...    26   5.5  

>SPAC1F7.13c |rpl801|rpl8-1, rpl18, rpk5a, rpl2-1, SPAC21E11.02c|60S
           ribosomal protein L8|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 253

 Score =  283 bits (694), Expect = 2e-77
 Identities = 129/184 (70%), Positives = 152/184 (82%)
 Frame = +3

Query: 105 RRGKALLNFAL*XYAERHGYIKGVVKDIIHDPGRGAPLAVVHFRDPYKFKTRKELFIAPE 284
           R+G A L      +AERHGYI+GVV+ IIHDPGRGAPLA V FR+PY ++T  E F+A E
Sbjct: 22  RKGAAQLRTL--DFAERHGYIRGVVQKIIHDPGRGAPLAKVAFRNPYHYRTDVETFVATE 79

Query: 285 GLYTGQFVYCGKKATLEVGNVMPVGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGHN 464
           G+YTGQFVYCGK A L VGNV+PVG MPEGTI+ N+EEK GDRG L R+SGN+  ++GH+
Sbjct: 80  GMYTGQFVYCGKNAALTVGNVLPVGEMPEGTIISNVEEKAGDRGALGRSSGNYVIIVGHD 139

Query: 465 PDAKRTRVKLPSGAKKVLPSSNRGMVGIVAGGGRIDKPILKAGRAYHKYKVKRNCWPYVR 644
            D  +TRVKLPSGAKKV+PSS RG+VGIVAGGGRIDKP+LKAGRA+HKY+VKRNCWP  R
Sbjct: 140 VDTGKTRVKLPSGAKKVVPSSARGVVGIVAGGGRIDKPLLKAGRAFHKYRVKRNCWPRTR 199

Query: 645 GVAM 656
           GVAM
Sbjct: 200 GVAM 203



 Score = 32.3 bits (70), Expect = 0.063
 Identities = 15/26 (57%), Positives = 21/26 (80%)
 Frame = +2

Query: 62  AQRKGAGSVFVSHTKKRKGAPKLRSL 139
           AQRK +G +F +HT+ RKGA +LR+L
Sbjct: 7   AQRK-SGGIFQAHTRLRKGAAQLRTL 31


>SPBC2F12.07c |rpl802|rpl8-2, rpk37, rpk5b|60S ribosomal protein
           L8|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 253

 Score =  283 bits (694), Expect = 2e-77
 Identities = 129/184 (70%), Positives = 152/184 (82%)
 Frame = +3

Query: 105 RRGKALLNFAL*XYAERHGYIKGVVKDIIHDPGRGAPLAVVHFRDPYKFKTRKELFIAPE 284
           R+G A L      +AERHGYI+GVV+ IIHDPGRGAPLA V FR+PY ++T  E F+A E
Sbjct: 22  RKGAAQLRTL--DFAERHGYIRGVVQKIIHDPGRGAPLAKVAFRNPYHYRTDVETFVATE 79

Query: 285 GLYTGQFVYCGKKATLEVGNVMPVGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGHN 464
           G+YTGQFVYCGK A L VGNV+PVG MPEGTI+ N+EEK GDRG L R+SGN+  ++GH+
Sbjct: 80  GMYTGQFVYCGKNAALTVGNVLPVGEMPEGTIISNVEEKAGDRGALGRSSGNYVIIVGHD 139

Query: 465 PDAKRTRVKLPSGAKKVLPSSNRGMVGIVAGGGRIDKPILKAGRAYHKYKVKRNCWPYVR 644
            D  +TRVKLPSGAKKV+PSS RG+VGIVAGGGRIDKP+LKAGRA+HKY+VKRNCWP  R
Sbjct: 140 VDTGKTRVKLPSGAKKVVPSSARGVVGIVAGGGRIDKPLLKAGRAFHKYRVKRNCWPRTR 199

Query: 645 GVAM 656
           GVAM
Sbjct: 200 GVAM 203



 Score = 32.3 bits (70), Expect = 0.063
 Identities = 15/26 (57%), Positives = 21/26 (80%)
 Frame = +2

Query: 62  AQRKGAGSVFVSHTKKRKGAPKLRSL 139
           AQRK +G +F +HT+ RKGA +LR+L
Sbjct: 7   AQRK-SGGIFQAHTRLRKGAAQLRTL 31


>SPBC839.04 |rpl803|rpl8-3, rpk5-b, rpkD4|60S ribosomal protein
           L8|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 253

 Score =  283 bits (694), Expect = 2e-77
 Identities = 129/184 (70%), Positives = 152/184 (82%)
 Frame = +3

Query: 105 RRGKALLNFAL*XYAERHGYIKGVVKDIIHDPGRGAPLAVVHFRDPYKFKTRKELFIAPE 284
           R+G A L      +AERHGYI+GVV+ IIHDPGRGAPLA V FR+PY ++T  E F+A E
Sbjct: 22  RKGAAQLRTL--DFAERHGYIRGVVQKIIHDPGRGAPLAKVAFRNPYHYRTDVETFVATE 79

Query: 285 GLYTGQFVYCGKKATLEVGNVMPVGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGHN 464
           G+YTGQFVYCGK A L VGNV+PVG MPEGTI+ N+EEK GDRG L R+SGN+  ++GH+
Sbjct: 80  GMYTGQFVYCGKNAALTVGNVLPVGEMPEGTIISNVEEKAGDRGALGRSSGNYVIIVGHD 139

Query: 465 PDAKRTRVKLPSGAKKVLPSSNRGMVGIVAGGGRIDKPILKAGRAYHKYKVKRNCWPYVR 644
            D  +TRVKLPSGAKKV+PSS RG+VGIVAGGGRIDKP+LKAGRA+HKY+VKRNCWP  R
Sbjct: 140 VDTGKTRVKLPSGAKKVVPSSARGVVGIVAGGGRIDKPLLKAGRAFHKYRVKRNCWPRTR 199

Query: 645 GVAM 656
           GVAM
Sbjct: 200 GVAM 203



 Score = 32.3 bits (70), Expect = 0.063
 Identities = 15/26 (57%), Positives = 21/26 (80%)
 Frame = +2

Query: 62  AQRKGAGSVFVSHTKKRKGAPKLRSL 139
           AQRK +G +F +HT+ RKGA +LR+L
Sbjct: 7   AQRK-SGGIFQAHTRLRKGAAQLRTL 31


>SPCC16C4.15 |rml2||mitochondrial ribosomal protein subunit
           L2|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 318

 Score = 42.3 bits (95), Expect = 6e-05
 Identities = 31/109 (28%), Positives = 57/109 (52%)
 Frame = +3

Query: 330 LEVGNVMPVGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGHNPDAKRTRVKLPSGAK 509
           L+ GN  P+  +P GT++  +      + +L R++G+ A +I    D K   V+L SG +
Sbjct: 162 LKPGNCFPLRLIPIGTVIHAIGVNPNQKAKLCRSAGSSARIIAF--DGKYAIVRLQSGEE 219

Query: 510 KVLPSSNRGMVGIVAGGGRIDKPILKAGRAYHKYKVKRNCWPYVRGVAM 656
           + +  ++   +G+V+      + + KAGR+  ++   R   P VRG AM
Sbjct: 220 RKILDTSFATIGVVSNIYWQHRQLGKAGRS--RWLGIR---PTVRGTAM 263


>SPBC1198.04c |zas1||zinc finger protein Zas1|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 897

 Score = 30.3 bits (65), Expect = 0.26
 Identities = 17/57 (29%), Positives = 24/57 (42%)
 Frame = -2

Query: 556 PATIPTMPLLLDGRTFLAPDGSFTLVRLASGLCPITVAKFPEARARRPLSPIFSSRL 386
           PAT+P          F  P   F   +L SGL    V+ +P+   +   +P   SRL
Sbjct: 246 PATVPITQAASTANAFQQPSNQFQTQKLPSGLDTRPVSSYPDELTQLESNPDSFSRL 302


>SPAC1F12.10c |||NADPH-hemoprotein reductase |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 147

 Score = 27.1 bits (57), Expect = 2.4
 Identities = 10/27 (37%), Positives = 15/27 (55%)
 Frame = +3

Query: 567 IDKPILKAGRAYHKYKVKRNCWPYVRG 647
           ++KPI        K+K K +CW  +RG
Sbjct: 68  VEKPIPVTKEELAKHKTKEDCWIAIRG 94


>SPAC23D3.10c |eng2||endo-1,3-beta-glucanase
           Eng2|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 706

 Score = 25.8 bits (54), Expect = 5.5
 Identities = 12/33 (36%), Positives = 17/33 (51%)
 Frame = -2

Query: 415 PLSPIFSSRLHTMVPSGIAPTGITFPTSRVAFF 317
           P++P+F SR H   P G+  T   FP     F+
Sbjct: 11  PINPVFPSRAHPSPPLGL--TSNLFPIQTNKFY 41


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,851,313
Number of Sequences: 5004
Number of extensions: 61117
Number of successful extensions: 172
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 164
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 172
length of database: 2,362,478
effective HSP length: 70
effective length of database: 2,012,198
effective search space used: 297805304
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -