SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120040.Seq
         (757 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC589.12 ||SPAC688.01|glycosylceramide biosynthesis protein |S...    30   0.41 
SPAC222.14c |||GTP binding protein Sey1 |Schizosaccharomyces pom...    28   1.3  
SPBC947.11c |elg1||DNA replication factor C complex subunit Elg1...    28   1.3  
SPAC644.04 |pct1||RNA 5'-triphosphatase|Schizosaccharomyces pomb...    28   1.7  
SPCC191.11 |inv1||beta-fructofuranosidase|Schizosaccharomyces po...    27   2.2  
SPAC12G12.09 |||sequence orphan|Schizosaccharomyces pombe|chr 1|...    27   2.2  
SPBC1E8.03c |||conserved fungal protein|Schizosaccharomyces pomb...    27   2.2  
SPBC1347.01c |rev1|SPBC215.16c|deoxycytidyl transferase Rev1 |Sc...    27   2.2  
SPCC895.05 |for3||formin For3|Schizosaccharomyces pombe|chr 3|||...    27   2.2  
SPBC2F12.09c |atf21||transcription factor Atf21|Schizosaccharomy...    27   3.8  
SPBC16C6.10 |chp2||chromodomain protein 2|Schizosaccharomyces po...    26   5.0  
SPAC30D11.09 |cwf19||complexed with Cdc5 protein Cwf19 |Schizosa...    26   6.7  
SPAC1556.01c |rad50|SPAP4C9.01c|DNA repair protein Rad50|Schizos...    26   6.7  
SPAC17H9.10c |ddb1||damaged DNA binding protein Ddb1 |Schizosacc...    26   6.7  
SPCC737.08 |||midasin |Schizosaccharomyces pombe|chr 3|||Manual        25   8.8  
SPCC5E4.06 |smc6|rad18|Smc5-6 complex SMC subunit Smc6|Schizosac...    25   8.8  
SPAC607.06c |||metallopeptidase|Schizosaccharomyces pombe|chr 1|...    25   8.8  

>SPAC589.12 ||SPAC688.01|glycosylceramide biosynthesis protein
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 971

 Score = 29.9 bits (64), Expect = 0.41
 Identities = 16/46 (34%), Positives = 21/46 (45%)
 Frame = +2

Query: 215 HFGSYTKRYAQEQHLRDRIKSKVDEQFDQLEREYSDKIDGFHDNIQ 352
           HFG     YA E  +RD ++    + F  LE +    I GF D  Q
Sbjct: 714 HFGLDNFMYASENRIRDAVRDMELDVFGLLESDTQRLIMGFRDLTQ 759


>SPAC222.14c |||GTP binding protein Sey1 |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 762

 Score = 28.3 bits (60), Expect = 1.3
 Identities = 17/48 (35%), Positives = 24/48 (50%)
 Frame = -1

Query: 571 IALGCCRSQIPASTRIPPRSSVVFVDQLGQTVFFVSFNRLFIGIIMTF 428
           I + C RS I  +TRIPP   V+ +  LG   F       F+ +I+ F
Sbjct: 643 IFMDCKRSVINTTTRIPPYFWVLLI-VLGWNEFMAILRNPFVFMILMF 689


>SPBC947.11c |elg1||DNA replication factor C complex subunit
           Elg1|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 920

 Score = 28.3 bits (60), Expect = 1.3
 Identities = 15/33 (45%), Positives = 18/33 (54%), Gaps = 2/33 (6%)
 Frame = -1

Query: 598 CYQSGCTQKIA--LGCCRSQIPASTRIPPRSSV 506
           C  S C  KIA  L  CR   P S+ +PP SS+
Sbjct: 338 CAFSQCLSKIADWLRSCRLTKPESSSVPPSSSI 370


>SPAC644.04 |pct1||RNA 5'-triphosphatase|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 303

 Score = 27.9 bits (59), Expect = 1.7
 Identities = 21/91 (23%), Positives = 41/91 (45%), Gaps = 2/91 (2%)
 Frame = +2

Query: 104 VPDGYSRLSCGRTNQRVGVH*QDYEHAIDKTRSHDV*HFGSYTKRYAQEQHLRD--RIKS 277
           +P G  + S  R   RVG   Q+ +  + KT  +D  +    T+R+  E    +   ++ 
Sbjct: 214 MPSGNQQPSLTRLKDRVGYVHQEIKIDLTKTTQNDPVY--DTTERHELEVEFGNIADLRD 271

Query: 278 KVDEQFDQLEREYSDKIDGFHDNIQYFKDEH 370
           +  +  D +E     ++  F DN++  + EH
Sbjct: 272 RAQKAKDGMEAPLFRRVQLFMDNVRILRREH 302


>SPCC191.11 |inv1||beta-fructofuranosidase|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 581

 Score = 27.5 bits (58), Expect = 2.2
 Identities = 19/49 (38%), Positives = 25/49 (51%), Gaps = 2/49 (4%)
 Frame = -3

Query: 206 HENGFCQLRVHN--LVNVHQLSGLFVHMTISNNRLGHVDFYRKNYTHFA 66
           HENG   L      +V+VH  SGLF + TI   R+  V  Y  ++T  A
Sbjct: 149 HENGVLSLPFSGSAVVDVHNSSGLFSNDTIPEERI--VLIYTDHWTGVA 195


>SPAC12G12.09 |||sequence orphan|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 977

 Score = 27.5 bits (58), Expect = 2.2
 Identities = 17/59 (28%), Positives = 35/59 (59%), Gaps = 1/59 (1%)
 Frame = +1

Query: 583 NPIGNKVI-VPFAHEINDTGLYEYDVLAYVDSVEFDGKQFEEFVQKLILPSSFNDSEKV 756
           N I +KVI V +A+     GL+++ + A+   +EF  ++ +  +Q+L+   +FN+S  +
Sbjct: 472 NDIIDKVICVSYANN-TILGLFDFGLCAFTQEIEFSNEKEKSPIQQLL---TFNNSNMI 526


>SPBC1E8.03c |||conserved fungal protein|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 477

 Score = 27.5 bits (58), Expect = 2.2
 Identities = 28/86 (32%), Positives = 42/86 (48%), Gaps = 3/86 (3%)
 Frame = +1

Query: 463 NLRKILFAPIGRQTQHCYVAVCVLKPGFENGSNQVLSF--EYNPIG-NKVIVPFAHEIND 633
           N   +LFAP+  Q    Y+AV +L P FE   +  + F  E + +G +K  +   H I  
Sbjct: 398 NSNIVLFAPVVFQKFQEYMAVRLLNPNFELPESNGIEFAHEDSVLGHSKPSLTEFHAI-- 455

Query: 634 TGLYEYDVLAYVDSVEFDGKQFEEFV 711
            GLY   V++Y     F+G    E+V
Sbjct: 456 LGLYSL-VISY---NHFEGSLSNEYV 477


>SPBC1347.01c |rev1|SPBC215.16c|deoxycytidyl transferase Rev1
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 935

 Score = 27.5 bits (58), Expect = 2.2
 Identities = 13/39 (33%), Positives = 20/39 (51%)
 Frame = +2

Query: 293 FDQLEREYSDKIDGFHDNIQYFKDEHYSVSCQNGSVLKS 409
           FD+   E  + + GFHD   YF  +   +  QN ++ KS
Sbjct: 17  FDEANDEAYESV-GFHDYADYFSRKQRKLQNQNAALYKS 54


>SPCC895.05 |for3||formin For3|Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 1461

 Score = 27.5 bits (58), Expect = 2.2
 Identities = 22/92 (23%), Positives = 37/92 (40%), Gaps = 2/92 (2%)
 Frame = +2

Query: 242 AQEQHLRDRIKSKVDEQFDQLERE--YSDKIDGFHDNIQYFKDEHYSVSCQNGSVLKSKF 415
           + EQHL+  + +KV + FD + R     D +D   +   Y    H   +  +GS +  + 
Sbjct: 633 SNEQHLQPGLLNKVSKSFDSVHRRNLSQDSLDAMTEQFSY----HVEPNILSGSGIPVRV 688

Query: 416 AKILKSHDYTDKKSIETYEKYCLPQLVDKHNT 511
               K+ D  +  S         P L D  +T
Sbjct: 689 HTPSKTEDLDESFSGSEISSSPSPLLPDVSDT 720


>SPBC2F12.09c |atf21||transcription factor Atf21|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 355

 Score = 26.6 bits (56), Expect = 3.8
 Identities = 15/53 (28%), Positives = 25/53 (47%)
 Frame = +1

Query: 529 VLKPGFENGSNQVLSFEYNPIGNKVIVPFAHEINDTGLYEYDVLAYVDSVEFD 687
           VL P F+NG+N     + N + N V +  A +     LY+    A  D + ++
Sbjct: 155 VLHPQFQNGTNAPYVVQSNLMQNNVNLTGAEQEKGLDLYKNSATANNDEIFYN 207


>SPBC16C6.10 |chp2||chromodomain protein 2|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 380

 Score = 26.2 bits (55), Expect = 5.0
 Identities = 15/47 (31%), Positives = 19/47 (40%)
 Frame = +2

Query: 338 HDNIQYFKDEHYSVSCQNGSVLKSKFAKILKSHDYTDKKSIETYEKY 478
           H N    K  + S SC+   V  SK + I    D  DKK  +    Y
Sbjct: 76  HGNSGSQKTHNVSFSCEIRKVKSSKLSPISNMEDSEDKKEEDESSSY 122


>SPAC30D11.09 |cwf19||complexed with Cdc5 protein Cwf19
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 639

 Score = 25.8 bits (54), Expect = 6.7
 Identities = 10/28 (35%), Positives = 16/28 (57%)
 Frame = +2

Query: 266 RIKSKVDEQFDQLEREYSDKIDGFHDNI 349
           R + K D  ++ LEREY    D F +++
Sbjct: 285 RAQLKKDPNYESLEREYQKACDDFENSL 312


>SPAC1556.01c |rad50|SPAP4C9.01c|DNA repair protein
           Rad50|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1290

 Score = 25.8 bits (54), Expect = 6.7
 Identities = 13/37 (35%), Positives = 19/37 (51%)
 Frame = +2

Query: 404 KSKFAKILKSHDYTDKKSIETYEKYCLPQLVDKHNTA 514
           +  F K ++  D   K   + YE   L +L+DKH TA
Sbjct: 463 REDFTKDVEKSDLWIKSLRQEYESKNLLELLDKHQTA 499


>SPAC17H9.10c |ddb1||damaged DNA binding protein Ddb1
            |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1072

 Score = 25.8 bits (54), Expect = 6.7
 Identities = 16/80 (20%), Positives = 40/80 (50%)
 Frame = +2

Query: 281  VDEQFDQLEREYSDKIDGFHDNIQYFKDEHYSVSCQNGSVLKSKFAKILKSHDYTDKKSI 460
            +D+Q  ++ R+Y      +  +++   +  Y V+  +G+ +      +  S   +D+K +
Sbjct: 877  IDDQLIEVARDYHPL---WATSVEILSERKYFVTEADGNAVILLRDNV--SPQLSDRKKL 931

Query: 461  ETYEKYCLPQLVDKHNTATW 520
              Y+K+ L +L++K    T+
Sbjct: 932  RWYKKFYLGELINKTRHCTF 951


>SPCC737.08 |||midasin |Schizosaccharomyces pombe|chr 3|||Manual
          Length = 4717

 Score = 25.4 bits (53), Expect = 8.8
 Identities = 21/94 (22%), Positives = 41/94 (43%), Gaps = 3/94 (3%)
 Frame = -3

Query: 476  IFRKFQ*TFYRYNHDFLKF*QTCFSTRCHFGNLPNSVH---L*NTGCYREIHQFYRCIRV 306
            IF K+  + +    DF++F + CF +R   GNL   +H     +T     +  ++    +
Sbjct: 2524 IFIKYTTSSFFLTDDFVRFIRVCFHSRIS-GNLLTLLHGISFDSTKAVAPVLTYFDFCSL 2582

Query: 305  LVDQIVHRLLILFCRANVVLARNASYRTRNVKHH 204
                I+ R+ + F      +  NA+  + N+  H
Sbjct: 2583 TTGNILGRIALAF----TSIDENANLESANIFEH 2612


>SPCC5E4.06 |smc6|rad18|Smc5-6 complex SMC subunit
           Smc6|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 1140

 Score = 25.4 bits (53), Expect = 8.8
 Identities = 17/67 (25%), Positives = 36/67 (53%), Gaps = 1/67 (1%)
 Frame = +2

Query: 272 KSKVDE-QFDQLEREYSDKIDGFHDNIQYFKDEHYSVSCQNGSVLKSKFAKILKSHDYTD 448
           ++K+++ +F + E+   +KI+G    I   + E  S+  Q  SVL ++  + L+      
Sbjct: 738 EAKIEQAKFKRDEQLLVEKIEGIKKRILLKRREVNSLESQELSVLDTEKIQTLERRISET 797

Query: 449 KKSIETY 469
           +K +E+Y
Sbjct: 798 EKELESY 804


>SPAC607.06c |||metallopeptidase|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 612

 Score = 25.4 bits (53), Expect = 8.8
 Identities = 12/17 (70%), Positives = 13/17 (76%), Gaps = 2/17 (11%)
 Frame = -3

Query: 236 ASY--RTRNVKHHENGF 192
           ASY  +T NVKHHEN F
Sbjct: 30  ASYCPQTINVKHHENSF 46


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,047,279
Number of Sequences: 5004
Number of extensions: 64111
Number of successful extensions: 192
Number of sequences better than 10.0: 17
Number of HSP's better than 10.0 without gapping: 182
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 192
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 361294920
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -