SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20040
         (701 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

12_01_0039 - 319871-319914,320021-320084,320198-320263,320397-32...    57   2e-08
11_01_0040 - 304439-304482,304589-304652,304766-304831,305509-30...    53   2e-07
12_02_0911 + 24236374-24237582                                         31   1.2  
03_02_0471 + 8734292-8734788,8735168-8735654,8735766-8736551           29   2.7  
02_05_0624 - 30451032-30451140,30451294-30451409,30451506-304515...    29   2.7  
05_05_0221 - 23385626-23386702                                         28   6.2  
07_03_0574 - 19629875-19631032                                         28   8.3  
07_01_0942 + 7957776-7958004,7958113-7958708                           28   8.3  

>12_01_0039 -
           319871-319914,320021-320084,320198-320263,320397-320458,
           321211-321298,321401-321461,321542-321625,322332-322630
          Length = 255

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 33/81 (40%), Positives = 45/81 (55%), Gaps = 3/81 (3%)
 Frame = +3

Query: 282 CYNMMRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLM 461
           C   + +QI  E  AS  Y ++ AYF  D V   GFAK F +++ EER+HA KL+ Y  M
Sbjct: 91  CEAAISEQINVEFNASYAYHSLFAYFDRDNVALKGFAKFFKESSDEERDHAEKLMKYQNM 150

Query: 462 RG---KLTGSVTDLITYRAPQ 515
           RG   +L   VT L  +  P+
Sbjct: 151 RGGRVRLQSIVTPLTEFDHPE 171



 Score = 30.7 bits (66), Expect = 1.2
 Identities = 17/44 (38%), Positives = 24/44 (54%)
 Frame = +2

Query: 542 ALEHALKLESDVTNSIREVIKTCESSFNDYHLVDYLSGEFLDEQ 673
           A+E AL LE  V   +   + +  S  ND  L D++  EFL+EQ
Sbjct: 178 AMELALALEKLVNEKLHN-LHSVASRCNDPQLTDFVESEFLEEQ 220


>11_01_0040 -
           304439-304482,304589-304652,304766-304831,305509-305640,
           305744-305804,305885-306018,306310-306654
          Length = 281

 Score = 53.2 bits (122), Expect = 2e-07
 Identities = 31/70 (44%), Positives = 40/70 (57%), Gaps = 3/70 (4%)
 Frame = +3

Query: 315 EVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG---KLTGSV 485
           E  AS  Y ++ AYF  D V   GFAK F +++ EER+HA KLI Y  MRG   +L   V
Sbjct: 134 EYNASYAYHSLFAYFDRDNVALKGFAKFFKESSDEERDHAEKLIKYQNMRGGRVRLQSIV 193

Query: 486 TDLITYRAPQ 515
           T L  +  P+
Sbjct: 194 TPLTEFDHPE 203


>12_02_0911 + 24236374-24237582
          Length = 402

 Score = 30.7 bits (66), Expect = 1.2
 Identities = 17/57 (29%), Positives = 31/57 (54%), Gaps = 2/57 (3%)
 Frame = +2

Query: 527 ESGASALEHA--LKLESDVTNSIREVIKTCESSFNDYHLVDYLSGEFLDEQYKGNAT 691
           ++GA+A + A  L+L+     S +EV          +H+ D+LS    +EQY G+++
Sbjct: 169 DAGAAAPQEAALLQLQQQTPASCQEVFVRSHGEEYGFHVDDFLSDACSNEQYSGDSS 225


>03_02_0471 + 8734292-8734788,8735168-8735654,8735766-8736551
          Length = 589

 Score = 29.5 bits (63), Expect = 2.7
 Identities = 15/36 (41%), Positives = 20/36 (55%)
 Frame = +2

Query: 533 GASALEHALKLESDVTNSIREVIKTCESSFNDYHLV 640
           G   LE+     +D+TN+  E I T  SS ND+ LV
Sbjct: 381 GCPHLEYWAVHVTDITNAALEAIGTYSSSLNDFRLV 416


>02_05_0624 -
           30451032-30451140,30451294-30451409,30451506-30451580,
           30452033-30452093,30452198-30452424
          Length = 195

 Score = 29.5 bits (63), Expect = 2.7
 Identities = 24/76 (31%), Positives = 33/76 (43%)
 Frame = +3

Query: 342 AMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRGKLTGSVTDLITYRAPQTR 521
           A+  YF + TV  P  A  FF +   +RE  T L+D LL       S   L  YR  + R
Sbjct: 115 ALPKYFQVGTVIEP--ASEFFSSRLTKRERKTTLVDELL-------SDQHLKNYRMRKVR 165

Query: 522 RGRAAHQPSSTPSSWR 569
             + +  P  +   WR
Sbjct: 166 EIQESRTPGGS-QKWR 180


>05_05_0221 - 23385626-23386702
          Length = 358

 Score = 28.3 bits (60), Expect = 6.2
 Identities = 20/63 (31%), Positives = 27/63 (42%)
 Frame = +2

Query: 227 SVTSAPSPSG*VAHHGADLLQHDEETDPGGSGRVNPVLSHGGLLLDRYGEPPRLREAILR 406
           + T+AP  S   +   ++L+    E     S  V   L HG  L   +G    L   ILR
Sbjct: 11  TATAAPVASPAASSMASELMAQGRE-----SAAVLEALLHGASLPPAHGGAHALAAEILR 65

Query: 407 CCD 415
           CCD
Sbjct: 66  CCD 68


>07_03_0574 - 19629875-19631032
          Length = 385

 Score = 27.9 bits (59), Expect = 8.3
 Identities = 16/45 (35%), Positives = 19/45 (42%), Gaps = 1/45 (2%)
 Frame = -3

Query: 351 PPWLSTGLTRPLPPGXXXXXXXXXSAPW*ATHPDGDG-ADVTLCS 220
           PP+   G+ RPLP           +  W  T P  DG A V  CS
Sbjct: 164 PPYADDGIGRPLPGSRVTALAVVGAGIWTTTAPAEDGVASVRPCS 208


>07_01_0942 + 7957776-7958004,7958113-7958708
          Length = 274

 Score = 27.9 bits (59), Expect = 8.3
 Identities = 16/33 (48%), Positives = 19/33 (57%)
 Frame = +1

Query: 454 CS*GES*QAP*PTSSRTGPRKHVVGERRISPRA 552
           C+ GE+   P   S R GP+ HVVG R   PRA
Sbjct: 108 CAGGEAQAQP---SGRAGPKSHVVG-RAFGPRA 136


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,240,696
Number of Sequences: 37544
Number of extensions: 388120
Number of successful extensions: 1025
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 997
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1025
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1803843684
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -