SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30156.Seq
         (961 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

03_06_0386 + 33555682-33556344,33557138-33557299                      143   2e-34
07_01_0756 + 5819367-5820038,5820847-5821005                          140   1e-33
03_04_0238 - 19219040-19219218,19220296-19220350,19221606-192216...    50   4e-06
07_03_0099 + 13387533-13387641,13387647-13387864,13388497-13388871     41   0.001
11_04_0439 + 17749634-17749858,17750164-17750301,17750770-177509...    29   5.5  
04_03_1049 + 22015053-22015083,22015770-22015885,22016013-220161...    28   9.6  
01_06_1005 + 33723743-33723946,33724035-33724256,33724789-337249...    28   9.6  

>03_06_0386 + 33555682-33556344,33557138-33557299
          Length = 274

 Score =  143 bits (346), Expect = 2e-34
 Identities = 68/96 (70%), Positives = 80/96 (83%)
 Frame = +1

Query: 256 LPIKEFEIIDFFLGPSLNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLGVKCSK 435
           LP+KE +I++  + P L DEV+KI PVQKQTRAGQRTRFKAFV +GDNNGH+GLGVKC+K
Sbjct: 70  LPVKEHQIVETLV-PGLKDEVMKITPVQKQTRAGQRTRFKAFVVVGDNNGHVGLGVKCAK 128

Query: 436 EVATAIRGAIILAKLSVLTSPKKLRGNKIGKPHNRP 543
           EVATAIRGAIILAKLSV+   +   GNKIG+PH  P
Sbjct: 129 EVATAIRGAIILAKLSVVPVRRGYWGNKIGQPHTVP 164



 Score = 52.4 bits (120), Expect = 5e-07
 Identities = 39/149 (26%), Positives = 67/149 (44%), Gaps = 2/149 (1%)
 Frame = +2

Query: 161 KEDQKEWVPVTKLGRLVREGKIDKLESIYLFFYQSKNSR--SLISSSARP*MMRFLRSCL 334
           ++++++WVPVTKLGRLV+EG+  K+E IYL     K  +    +    +  +M+   + +
Sbjct: 38  RQEEEKWVPVTKLGRLVKEGRFSKIEEIYLHSLPVKEHQIVETLVPGLKDEVMKI--TPV 95

Query: 335 YRNKHVPDSAHVSRHLLPLATTTVILVWV*SAARKSPLPFEALLSLLSCQF*PVRRSYGV 514
            +             ++       + + V   A++        + L      PVRR Y  
Sbjct: 96  QKQTRAGQRTRFKAFVVVGDNNGHVGLGV-KCAKEVATAIRGAIILAKLSVVPVRRGYWG 154

Query: 515 TR*ESHTTVPCKVXGQXWFPKQFRLIPAP 601
            +     TVPCKV G+       R++PAP
Sbjct: 155 NKIGQPHTVPCKVTGKCG-SVTVRMVPAP 182


>07_01_0756 + 5819367-5820038,5820847-5821005
          Length = 276

 Score =  140 bits (340), Expect = 1e-33
 Identities = 70/108 (64%), Positives = 83/108 (76%)
 Frame = +1

Query: 220 KNRQTREHLLVFLPIKEFEIIDFFLGPSLNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDN 399
           K  +  E  L  LP+KE +I++  + P L DEV+KI PVQKQTRAGQRTRFKAFV +GD 
Sbjct: 61  KIHKIEEIYLHSLPVKEHQIVEQLV-PGLKDEVMKITPVQKQTRAGQRTRFKAFVVVGDG 119

Query: 400 NGHIGLGVKCSKEVATAIRGAIILAKLSVLTSPKKLRGNKIGKPHNRP 543
           +GH+GLGVKC+KEVATAIRGAIILAKLSV+   +   GNKIGKPH  P
Sbjct: 120 DGHVGLGVKCAKEVATAIRGAIILAKLSVVPVRRGYWGNKIGKPHTVP 167



 Score = 51.2 bits (117), Expect = 1e-06
 Identities = 40/149 (26%), Positives = 68/149 (45%), Gaps = 2/149 (1%)
 Frame = +2

Query: 161 KEDQKEWVPVTKLGRLVREGKIDKLESIYLFFYQSKNSRSL--ISSSARP*MMRFLRSCL 334
           ++++++WVPVTKLGRLV+E KI K+E IYL     K  + +  +    +  +M+   + +
Sbjct: 41  RQEEEKWVPVTKLGRLVKENKIHKIEEIYLHSLPVKEHQIVEQLVPGLKDEVMKI--TPV 98

Query: 335 YRNKHVPDSAHVSRHLLPLATTTVILVWV*SAARKSPLPFEALLSLLSCQF*PVRRSYGV 514
            +             ++       + + V   A++        + L      PVRR Y  
Sbjct: 99  QKQTRAGQRTRFKAFVVVGDGDGHVGLGV-KCAKEVATAIRGAIILAKLSVVPVRRGYWG 157

Query: 515 TR*ESHTTVPCKVXGQXWFPKQFRLIPAP 601
            +     TVPCKV G+       R++PAP
Sbjct: 158 NKIGKPHTVPCKVTGKCG-SVTVRMVPAP 185


>03_04_0238 -
           19219040-19219218,19220296-19220350,19221606-19221690,
           19222068-19222798
          Length = 349

 Score = 49.6 bits (113), Expect = 4e-06
 Identities = 22/64 (34%), Positives = 40/64 (62%)
 Frame = +1

Query: 307 NDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLGVKCSKEVATAIRGAIILAKLSV 486
           ++ V+++  V K  + G++  F+A V +GD  GH+G+GV  +KEV  AI  A +  + ++
Sbjct: 171 SERVVQVNRVTKVVKGGRQLSFRAIVVVGDMKGHVGVGVGKAKEVTEAITKAAMNGRRNL 230

Query: 487 LTSP 498
           +T P
Sbjct: 231 VTVP 234


>07_03_0099 + 13387533-13387641,13387647-13387864,13388497-13388871
          Length = 233

 Score = 41.1 bits (92), Expect = 0.001
 Identities = 20/32 (62%), Positives = 24/32 (75%)
 Frame = +1

Query: 379 FVAIGDNNGHIGLGVKCSKEVATAIRGAIILA 474
           FV +GD + HI LGVKC+K  AT + GAIILA
Sbjct: 2   FVVVGDGDSHIELGVKCAK--ATTMSGAIILA 31


>11_04_0439 +
           17749634-17749858,17750164-17750301,17750770-17750943,
           17751099-17751184,17751264-17751525,17751616-17751815,
           17753631-17754086,17754198-17754474,17754694-17754828,
           17754946-17755026,17756305-17756400,17756676-17756771,
           17756844-17756900,17756975-17757043,17757158-17757237,
           17758185-17758329,17758422-17758511,17758914-17758994,
           17759103-17759198,17759279-17759335,17759417-17759461,
           17759547-17759612,17760304-17760350,17762771-17762865,
           17763375-17763393,17763438-17763498,17763637-17763660
          Length = 1085

 Score = 29.1 bits (62), Expect = 5.5
 Identities = 14/39 (35%), Positives = 20/39 (51%)
 Frame = -2

Query: 441 DFLAALHTQTNMTVVVANGNKCLETCALSGTCLFLYRHD 325
           +F+A LHT  +M   V      +E C LS    F+ +HD
Sbjct: 655 EFIAYLHTYVDMLHKVDEIGDTMEDCYLSSPIKFVSKHD 693


>04_03_1049 + 22015053-22015083,22015770-22015885,22016013-22016108,
            22016229-22016285,22016468-22016620,22016754-22016838,
            22017097-22017187,22017324-22017488,22017813-22017932,
            22018020-22018104,22018234-22018402,22019055-22019173,
            22019250-22019440,22019746-22019957,22020905-22021500,
            22022538-22022658,22023439-22023868,22024412-22024797,
            22024976-22025071,22025380-22025432,22026915-22027061,
            22027139-22027309,22027880-22027962,22028049-22028247,
            22028668-22028789,22029752-22029818,22029960-22030010,
            22030768-22031001,22031263-22031451,22032455-22032646,
            22032742-22032936
          Length = 1673

 Score = 28.3 bits (60), Expect = 9.6
 Identities = 11/28 (39%), Positives = 17/28 (60%)
 Frame = -3

Query: 116  DRHGLYLHRVIRIRRENRHVHRLEQRPP 33
            D HGL+    + +    RH+HR+E +PP
Sbjct: 1006 DMHGLHASEAVEVLE--RHLHRIEFQPP 1031


>01_06_1005 +
           33723743-33723946,33724035-33724256,33724789-33724901,
           33725581-33725950
          Length = 302

 Score = 28.3 bits (60), Expect = 9.6
 Identities = 25/73 (34%), Positives = 32/73 (43%), Gaps = 2/73 (2%)
 Frame = +2

Query: 503 SYGVTR*ESHTTVPCKVXGQXWF--PKQFRLIPAPSVGNW*LCSCXKFPKESFLSDGLGV 676
           S  +TR  S T  PC+V G  +F  P   +LI      +    S   F K    S+ LG 
Sbjct: 127 SISITRLASATNRPCQVIGMHFFNPPPIMKLIEIIRGAD---TSEEVFTKVKSFSERLGK 183

Query: 677 TXICXQRSSFXGF 715
           T IC Q   + GF
Sbjct: 184 TVICSQ--DYPGF 194


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 22,838,784
Number of Sequences: 37544
Number of extensions: 460635
Number of successful extensions: 1127
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 1079
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1125
length of database: 14,793,348
effective HSP length: 82
effective length of database: 11,714,740
effective search space used: 2776393380
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -