SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20054
         (677 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_58796| Best HMM Match : TIG (HMM E-Value=6.3e-22)                  101   7e-22
SB_20938| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.28 
SB_13783| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   1.5  

>SB_58796| Best HMM Match : TIG (HMM E-Value=6.3e-22)
          Length = 1709

 Score =  101 bits (241), Expect = 7e-22
 Identities = 46/84 (54%), Positives = 64/84 (76%)
 Frame = +2

Query: 11   FLLFKAIKHQIEKGVVDAITHEARYSLSEEKLLKEQIDYQTVTLHIVQDEFDEKVQCKVL 190
            F++FKAIK Q+ KG VDA+T EARYSLSE+KLL++ IDY+ + +++  ++        VL
Sbjct: 1318 FMMFKAIKRQVGKGPVDAVTGEARYSLSEDKLLRQTIDYEEIRVNVTFED-QPPTMVTVL 1376

Query: 191  DCDSISQVKSKILDALFKNTPFHS 262
            DCDS+SQ KSK+LDA++KN PF S
Sbjct: 1377 DCDSVSQAKSKMLDAVYKNVPFSS 1400



 Score = 44.8 bits (101), Expect = 7e-05
 Identities = 22/60 (36%), Positives = 31/60 (51%)
 Frame = +1

Query: 256  SLRPAVHEVDLEWRHGRGGHVTLQDEDVTTKTLNGWRKLNTLAHYGVKESAIMSLISRQN 435
            S R     + L+W    G    L+D+D ++     WRKLNTL HY V + A + L  RQ+
Sbjct: 1399 SSRVEAETLQLDWHLTDGSVKPLRDDDASSVVEGPWRKLNTLGHYKVTDGANLKLSPRQS 1458


>SB_20938| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 205

 Score = 32.7 bits (71), Expect = 0.28
 Identities = 19/55 (34%), Positives = 29/55 (52%)
 Frame = +1

Query: 370 LNTLAHYGVKESAIMSLISRQNDSFNTPYKIPCKNCTGIYCSNSHIPYTIATLLI 534
           L  L H  VK + +  ++S  +  F+ PY I  +NC G + S S I Y  + +LI
Sbjct: 40  LRGLLHKTVKVATVARVVS--DIIFSHPYWITSQNCQGCHSSASRIRYHFSRILI 92



 Score = 28.3 bits (60), Expect = 6.0
 Identities = 18/57 (31%), Positives = 29/57 (50%)
 Frame = +1

Query: 364 RKLNTLAHYGVKESAIMSLISRQNDSFNTPYKIPCKNCTGIYCSNSHIPYTIATLLI 534
           R L  L H  VK + +  ++S  +  F+ PY +  +NC G + S   I Y  + +LI
Sbjct: 89  RILIGLLHKTVKVAVVARVVS--DIIFSHPYWLTSQNCQGGHSSARRIRYHFSRILI 143


>SB_13783| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 277

 Score = 30.3 bits (65), Expect = 1.5
 Identities = 15/52 (28%), Positives = 29/52 (55%), Gaps = 1/52 (1%)
 Frame = +2

Query: 74  EARYSLSEEKLLKEQIDYQTVTLHIVQDEFDEKVQ-CKVLDCDSISQVKSKI 226
           E   S  +++++ EQID++ +     +D F  K+   K ++CDS  ++K  I
Sbjct: 8   EIMISNHKDEVIYEQIDFEKINCVTQEDRFGTKMNGVKEMNCDSNLRIKDMI 59


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,090,416
Number of Sequences: 59808
Number of extensions: 375737
Number of successful extensions: 1200
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 1075
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1191
length of database: 16,821,457
effective HSP length: 80
effective length of database: 12,036,817
effective search space used: 1745338465
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -