SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20017
         (763 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_16061| Best HMM Match : 7tm_1 (HMM E-Value=5.9)                     31   1.0  
SB_20225| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   7.2  
SB_3546| Best HMM Match : 7tm_1 (HMM E-Value=1.5e-29)                  28   9.5  

>SB_16061| Best HMM Match : 7tm_1 (HMM E-Value=5.9)
          Length = 119

 Score = 31.1 bits (67), Expect = 1.0
 Identities = 17/47 (36%), Positives = 27/47 (57%), Gaps = 3/47 (6%)
 Frame = +1

Query: 64  KCHQIISK---RRYLIIPIKKLYIQYATPLLTLLVLSFSNIMQKWQR 195
           +C  II+K   R+++I  I K  + YA PLLT+ +L    +   W+R
Sbjct: 69  RCMPIITKDWQRQFMIEFIIKFMVTYAVPLLTMAILYSIIVCLLWKR 115


>SB_20225| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1548

 Score = 28.3 bits (60), Expect = 7.2
 Identities = 13/39 (33%), Positives = 26/39 (66%)
 Frame = +1

Query: 61  MKCHQIISKRRYLIIPIKKLYIQYATPLLTLLVLSFSNI 177
           +KC +++  R + ++     Y +Y+T LLTLL+L+F+ +
Sbjct: 234 LKCGRLL--RLFRVVRKLHRYTEYSTVLLTLLMLAFAMV 270


>SB_3546| Best HMM Match : 7tm_1 (HMM E-Value=1.5e-29)
          Length = 447

 Score = 27.9 bits (59), Expect = 9.5
 Identities = 15/38 (39%), Positives = 18/38 (47%)
 Frame = +1

Query: 85  KRRYLIIPIKKLYIQYATPLLTLLVLSFSNIMQKWQRD 198
           K RY I    K  I YA PL+T+  L    I   WQ +
Sbjct: 189 KHRYAIEMTVKFIITYAFPLITMATLYTIIIWYLWQHN 226


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 21,282,471
Number of Sequences: 59808
Number of extensions: 401617
Number of successful extensions: 704
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 676
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 704
length of database: 16,821,457
effective HSP length: 80
effective length of database: 12,036,817
effective search space used: 2082369341
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -