SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20014
         (597 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_19540| Best HMM Match : Pro_isomerase (HMM E-Value=1.5e-23)         93   2e-19
SB_40010| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   4e-06
SB_42363| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.8  
SB_7938| Best HMM Match : No HMM Matches (HMM E-Value=.)               29   3.8  
SB_52819| Best HMM Match : E-MAP-115 (HMM E-Value=0.82)                28   5.0  
SB_44616| Best HMM Match : rve (HMM E-Value=0.012)                     28   5.0  
SB_36341| Best HMM Match : DUF329 (HMM E-Value=1.7)                    28   5.0  
SB_36215| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   6.6  
SB_41075| Best HMM Match : RVT_1 (HMM E-Value=2.1e-30)                 28   6.6  
SB_54813| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   8.7  

>SB_19540| Best HMM Match : Pro_isomerase (HMM E-Value=1.5e-23)
          Length = 741

 Score = 92.7 bits (220), Expect = 2e-19
 Identities = 41/80 (51%), Positives = 59/80 (73%)
 Frame = +1

Query: 28  MKQIVANQKVKIPDGLTVHVKSRLVTVKGPRGVLKRNFKHLAVDIRMVNPRLLKVEKWFG 207
           MK I+A++ V IPD + V VKSR+VTV GPRG LKRNF+HL +++  V    ++V+ WF 
Sbjct: 557 MKTILASETVTIPDNVEVKVKSRVVTVTGPRGTLKRNFRHLRLELTKVGKDKVRVDVWFA 616

Query: 208 SKKELAAVRTVCSHVET*LK 267
           S+KELA V+T+ +H+E  +K
Sbjct: 617 SRKELACVKTIITHIENMIK 636



 Score = 84.2 bits (199), Expect = 7e-17
 Identities = 35/52 (67%), Positives = 43/52 (82%)
 Frame = +3

Query: 255 NMIKGVTKGFQYKMRAVYAHFPINCVTTEGNSIIEIRNFLGEKYIRRVKMAP 410
           NMIKGV  G++YKMRAVYAHFPIN    E  +++E+RNFLGEKY+RRV+M P
Sbjct: 633 NMIKGVIYGYRYKMRAVYAHFPINIAIQENGTLVEVRNFLGEKYVRRVRMRP 684


>SB_40010| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 34

 Score = 48.4 bits (110), Expect = 4e-06
 Identities = 21/25 (84%), Positives = 24/25 (96%)
 Frame = +1

Query: 508 TTTVKNKDIRKFLDGLYVSEKTTVV 582
           +T VKNKDIRKFLDG+YVSEKTT+V
Sbjct: 7   STKVKNKDIRKFLDGVYVSEKTTIV 31


>SB_42363| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 218

 Score = 28.7 bits (61), Expect = 3.8
 Identities = 13/31 (41%), Positives = 18/31 (58%)
 Frame = -1

Query: 189 LQETRVYHANVNSQVFEVPFENSAGPFNCHQ 97
           L  TR+ +  V+S   EV  E S  P++CHQ
Sbjct: 160 LYNTRIPNVTVSSDGGEVELEISDDPYDCHQ 190


>SB_7938| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 203

 Score = 28.7 bits (61), Expect = 3.8
 Identities = 17/48 (35%), Positives = 25/48 (52%)
 Frame = -2

Query: 242 QTVLTAASSFLDPNHFSTFRRRGFTMRMSTAKCLKFLLRTPRGPLTVT 99
           QT++T A  F D       RRR F+  +S   C + L R+P  P++ T
Sbjct: 85  QTMITTA--FPDTRKSPLTRRRNFSDGVSDLSCTENLARSPCAPVSPT 130


>SB_52819| Best HMM Match : E-MAP-115 (HMM E-Value=0.82)
          Length = 883

 Score = 28.3 bits (60), Expect = 5.0
 Identities = 13/38 (34%), Positives = 23/38 (60%)
 Frame = +1

Query: 10  VKQSPNMKQIVANQKVKIPDGLTVHVKSRLVTVKGPRG 123
           ++ +  +K++  + K K  DG+ VH K+   TV+ PRG
Sbjct: 98  LQNAKRIKKLEEDLKKKTCDGVLVHRKAVAATVEEPRG 135


>SB_44616| Best HMM Match : rve (HMM E-Value=0.012)
          Length = 1189

 Score = 28.3 bits (60), Expect = 5.0
 Identities = 17/49 (34%), Positives = 28/49 (57%), Gaps = 4/49 (8%)
 Frame = +1

Query: 58  KIPDGLTVHVKSRLVTVKGPRG---VLKRNFKHL-AVDIRMVNPRLLKV 192
           K+ DGL VH+ ++ V  K P+    + KR  + L A+ I + +P + KV
Sbjct: 4   KLDDGLRVHIVTQYVLFKNPKKLEIIAKRQKETLEALQINLDHPHVAKV 52


>SB_36341| Best HMM Match : DUF329 (HMM E-Value=1.7)
          Length = 197

 Score = 28.3 bits (60), Expect = 5.0
 Identities = 18/44 (40%), Positives = 20/44 (45%), Gaps = 7/44 (15%)
 Frame = -1

Query: 180 TRVYHANVNSQVFEVP-------FENSAGPFNCHQTRFHMDRKP 70
           TR YH NV   VF V        F  S G  N HQ  +  DR+P
Sbjct: 57  TRSYHENVVRPVFGVSDYWYRYEFAKSRGQINRHQLSWREDRQP 100


>SB_36215| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1427

 Score = 27.9 bits (59), Expect = 6.6
 Identities = 14/38 (36%), Positives = 22/38 (57%), Gaps = 2/38 (5%)
 Frame = +3

Query: 42   SKSESQNPRRAYGPCEIASGDS*RAPRS--SQKELQTL 149
            S+ ++    R Y PC I SG++  APR    +KE++ L
Sbjct: 1363 SEDDTTTGARRYRPCPIESGNTYEAPRQVVMEKEVEEL 1400


>SB_41075| Best HMM Match : RVT_1 (HMM E-Value=2.1e-30)
          Length = 1152

 Score = 27.9 bits (59), Expect = 6.6
 Identities = 12/22 (54%), Positives = 16/22 (72%)
 Frame = +1

Query: 85   VKSRLVTVKGPRGVLKRNFKHL 150
            V++R  TV  PRG L+RN +HL
Sbjct: 1069 VETRSYTVSTPRGELRRNRRHL 1090


>SB_54813| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 422

 Score = 27.5 bits (58), Expect = 8.7
 Identities = 21/80 (26%), Positives = 33/80 (41%)
 Frame = -3

Query: 403 IFTLLMYFSPKKLRISIIELPSVVTQLMGK*AYTARILYWKPLVTPLIMFLHVNRLSSRR 224
           IF+ +  ++P+K + +I+ LP +         + A  L WKP    L   L +    S  
Sbjct: 18  IFSRVSGYTPRKRKTAILALPFLARPKWRPFGFVAFPLRWKPTERLLRRLLGLAARDSNN 77

Query: 223 QAPFWIRTISQPSGDEGLPC 164
            +   I     P GD   PC
Sbjct: 78  TSVLPI----APGGDTADPC 93


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,342,536
Number of Sequences: 59808
Number of extensions: 401149
Number of successful extensions: 1024
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 978
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1024
length of database: 16,821,457
effective HSP length: 79
effective length of database: 12,096,625
effective search space used: 1439498375
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -