BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0055.Seq (698 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_4835| Best HMM Match : WWE (HMM E-Value=3.7e-19) 100 2e-21 SB_57045| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_9017| Best HMM Match : zf-C3HC4 (HMM E-Value=7.9e-12) 39 0.004 SB_27532| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_14352| Best HMM Match : NHL (HMM E-Value=2.8026e-45) 37 0.018 SB_29221| Best HMM Match : zf-C3HC4 (HMM E-Value=7.5e-10) 37 0.018 SB_40057| Best HMM Match : zf-B_box (HMM E-Value=1.4e-08) 36 0.032 SB_44019| Best HMM Match : TPR_2 (HMM E-Value=4.9e-12) 35 0.055 SB_18658| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.055 SB_22201| Best HMM Match : zf-C3HC4 (HMM E-Value=8.1e-10) 34 0.13 SB_2107| Best HMM Match : zf-B_box (HMM E-Value=3.9e-08) 34 0.13 SB_39478| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_39287| Best HMM Match : NHL (HMM E-Value=1.5e-21) 34 0.13 SB_30389| Best HMM Match : Helicase_C (HMM E-Value=3.3e-21) 34 0.13 SB_27080| Best HMM Match : zf-C3HC4 (HMM E-Value=8.1e-10) 34 0.13 SB_54221| Best HMM Match : zf-B_box (HMM E-Value=2.1e-17) 33 0.17 SB_13725| Best HMM Match : zf-B_box (HMM E-Value=6e-14) 33 0.17 SB_5526| Best HMM Match : zf-C3HC4 (HMM E-Value=2) 33 0.17 SB_35560| Best HMM Match : zf-B_box (HMM E-Value=1e-20) 33 0.22 SB_19774| Best HMM Match : WWE (HMM E-Value=5.4e-24) 33 0.29 SB_46701| Best HMM Match : zf-B_box (HMM E-Value=1.4e-17) 32 0.39 SB_37011| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.39 SB_21628| Best HMM Match : zf-B_box (HMM E-Value=1.4e-17) 32 0.39 SB_6628| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-09) 32 0.39 SB_51226| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-09) 32 0.39 SB_47995| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-09) 32 0.39 SB_43880| Best HMM Match : zf-B_box (HMM E-Value=5.1e-15) 32 0.39 SB_6802| Best HMM Match : zf-B_box (HMM E-Value=5e-18) 32 0.39 SB_28248| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-10) 32 0.51 SB_26592| Best HMM Match : zf-B_box (HMM E-Value=1.3e-18) 32 0.51 SB_20056| Best HMM Match : zf-C3HC4 (HMM E-Value=9e-11) 32 0.51 SB_7987| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.51 SB_6888| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.51 SB_57688| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-08) 32 0.51 SB_56644| Best HMM Match : zf-C3HC4 (HMM E-Value=2.9e-07) 32 0.51 SB_53640| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-10) 32 0.51 SB_48027| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-10) 32 0.51 SB_41431| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.51 SB_30107| Best HMM Match : zf-C3HC4 (HMM E-Value=2.9e-07) 32 0.51 SB_30093| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-08) 32 0.51 SB_22421| Best HMM Match : zf-B_box (HMM E-Value=4e-17) 32 0.51 SB_14063| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-08) 32 0.51 SB_11572| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.51 SB_24485| Best HMM Match : zf-CCCH (HMM E-Value=3e-09) 31 0.68 SB_11151| Best HMM Match : Neur_chan_memb (HMM E-Value=3.6e-10) 31 0.68 SB_4090| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.68 SB_57762| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.90 SB_18515| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.90 SB_14518| Best HMM Match : MIB_HERC2 (HMM E-Value=2.4e-38) 31 0.90 SB_7188| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.90 SB_944| Best HMM Match : zf-B_box (HMM E-Value=6.7e-15) 31 0.90 SB_43903| Best HMM Match : FHA (HMM E-Value=4.6e-13) 31 0.90 SB_5620| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.90 SB_31692| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_22639| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_4488| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_33568| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_18762| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_44886| Best HMM Match : zf-C3HC4 (HMM E-Value=1.3e-06) 30 2.1 SB_50665| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_38753| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_38368| Best HMM Match : zf-C3HC4 (HMM E-Value=4.4e-15) 30 2.1 SB_23299| Best HMM Match : zf-C3HC4 (HMM E-Value=5.9e-06) 30 2.1 SB_22842| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_16517| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-07) 30 2.1 SB_37786| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_19782| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_20928| Best HMM Match : NHL (HMM E-Value=0) 29 3.6 SB_7039| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_37498| Best HMM Match : MATH (HMM E-Value=1.8e-28) 29 3.6 SB_384| Best HMM Match : IBR (HMM E-Value=1.1e-12) 29 3.6 SB_25082| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_47830| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_59028| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-05) 28 6.3 SB_41147| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_37345| Best HMM Match : zf-B_box (HMM E-Value=1.3e-23) 28 6.3 SB_34455| Best HMM Match : Herpes_UL3 (HMM E-Value=1.8) 28 6.3 SB_29995| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-05) 28 6.3 SB_24395| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_19615| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_16508| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_14081| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_52478| Best HMM Match : NHL (HMM E-Value=1e-27) 28 6.3 SB_39493| Best HMM Match : zf-TRAF (HMM E-Value=1.5e-09) 28 6.3 SB_5773| Best HMM Match : HA2 (HMM E-Value=3e-16) 28 6.3 SB_56142| Best HMM Match : zf-B_box (HMM E-Value=2.9e-10) 28 8.4 SB_38475| Best HMM Match : ASC (HMM E-Value=3.1e-14) 28 8.4 SB_11435| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 >SB_4835| Best HMM Match : WWE (HMM E-Value=3.7e-19) Length = 320 Score = 99.5 bits (237), Expect = 2e-21 Identities = 43/102 (42%), Positives = 64/102 (62%), Gaps = 5/102 (4%) Frame = +2 Query: 218 FLFSLCEGCSSSSRKCAMCRTEIPLDYFENPVLL-----DKSNLQYAANVDGVEGFQWYY 382 F F +G + SRKCA+CR I DY + P L+ S+ A + + + W+Y Sbjct: 90 FCFLCIKGVALRSRKCAICRQPISPDYLDKPTLVKVVSGQSSSSDKAPSDPPADEYVWFY 149 Query: 383 EGRNGWWKYDERSNSELENAFNNGESECTLLLAGTLYIVDFQ 508 EGRNGWW+YD +++ E+E+AF G+ CTLL+AG LY++DF+ Sbjct: 150 EGRNGWWQYDTKTSKEVESAFKGGKRSCTLLIAGFLYLIDFE 191 Score = 59.3 bits (137), Expect = 3e-09 Identities = 22/38 (57%), Positives = 29/38 (76%) Frame = +3 Query: 135 IFSHNMEYDCAVCLQKCQHPTKLSCGHVFCFLCVKGVA 248 IF + + DC VCLQ+ +P +L CGH+FCFLC+KGVA Sbjct: 62 IFELDYQPDCPVCLQQASYPVRLPCGHMFCFLCIKGVA 99 >SB_57045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 362 Score = 38.7 bits (86), Expect = 0.004 Identities = 13/32 (40%), Positives = 21/32 (65%) Frame = +3 Query: 153 EYDCAVCLQKCQHPTKLSCGHVFCFLCVKGVA 248 E +C +CL++ + P L C H FC+ C+ G+A Sbjct: 13 EVECPICLERFKDPRVLPCLHTFCYECLVGLA 44 >SB_9017| Best HMM Match : zf-C3HC4 (HMM E-Value=7.9e-12) Length = 203 Score = 38.7 bits (86), Expect = 0.004 Identities = 13/32 (40%), Positives = 21/32 (65%) Frame = +3 Query: 153 EYDCAVCLQKCQHPTKLSCGHVFCFLCVKGVA 248 E +C +CL++ + P L C H FC+ C+ G+A Sbjct: 13 EVECPICLERFKDPRVLPCLHTFCYECLVGLA 44 >SB_27532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 649 Score = 37.1 bits (82), Expect = 0.014 Identities = 14/32 (43%), Positives = 20/32 (62%) Frame = +3 Query: 162 CAVCLQKCQHPTKLSCGHVFCFLCVKGVAHQA 257 C VCL + ++P L C H FC CV+ + HQ+ Sbjct: 20 CPVCLGEYKNPMLLRCYHSFCLRCVQELLHQS 51 >SB_14352| Best HMM Match : NHL (HMM E-Value=2.8026e-45) Length = 784 Score = 36.7 bits (81), Expect = 0.018 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = +3 Query: 162 CAVCLQKCQHPTKLSCGHVFCFLCVKGVAHQAEN 263 C VC Q+ P L C H FC C++G+A + E+ Sbjct: 62 CRVCNQRFNKPKLLHCLHSFCQSCIEGLARKTED 95 >SB_29221| Best HMM Match : zf-C3HC4 (HMM E-Value=7.5e-10) Length = 337 Score = 36.7 bits (81), Expect = 0.018 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = +3 Query: 153 EYDCAVCLQKCQHPTKLSCGHVFCFLCVKGVAHQAENVQC 272 ++ C +CLQ P L C H FC +C +A N+QC Sbjct: 34 DFTCPICLQLLVEPVVLPCEHEFCKMCFTQNVQEA-NLQC 72 >SB_40057| Best HMM Match : zf-B_box (HMM E-Value=1.4e-08) Length = 584 Score = 35.9 bits (79), Expect = 0.032 Identities = 13/39 (33%), Positives = 24/39 (61%), Gaps = 2/39 (5%) Frame = +3 Query: 162 CAVCLQKCQHPTKLSCGHVFCFLCVKGVAH--QAENVQC 272 C +CL++ Q P L+C H +C C++ +A Q +++ C Sbjct: 16 CCLCLEQYQDPRVLACLHTYCRHCLESLAEHSQGDSISC 54 >SB_44019| Best HMM Match : TPR_2 (HMM E-Value=4.9e-12) Length = 654 Score = 35.1 bits (77), Expect = 0.055 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +3 Query: 153 EYDCAVCLQKCQHPTKLSCGHVFCFLCV 236 E++C +C + +P CGHVFC C+ Sbjct: 376 EFECTLCCRLFYNPVTTPCGHVFCRACL 403 >SB_18658| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 337 Score = 35.1 bits (77), Expect = 0.055 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = +3 Query: 153 EYDCAVCLQKCQHPTKLSCGHVFCFLCVKGVAHQAENVQC 272 ++ C +C + P +CGHVFC C+ V AEN C Sbjct: 54 DFKCGICFGVLEDPLVTTCGHVFCSQCL--VHWIAENGTC 91 >SB_22201| Best HMM Match : zf-C3HC4 (HMM E-Value=8.1e-10) Length = 604 Score = 33.9 bits (74), Expect = 0.13 Identities = 15/39 (38%), Positives = 23/39 (58%), Gaps = 2/39 (5%) Frame = +3 Query: 162 CAVCLQKCQHPTKLSCGHVFCFLCVKG-VAH-QAENVQC 272 C++CL++ Q P L+C H +C C++ V H Q V C Sbjct: 17 CSLCLEQYQDPRVLACLHTYCRHCLESLVEHSQERTVSC 55 >SB_2107| Best HMM Match : zf-B_box (HMM E-Value=3.9e-08) Length = 599 Score = 33.9 bits (74), Expect = 0.13 Identities = 15/39 (38%), Positives = 23/39 (58%), Gaps = 2/39 (5%) Frame = +3 Query: 162 CAVCLQKCQHPTKLSCGHVFCFLCVKG-VAHQAE-NVQC 272 C++CL++ Q P L+C H +C C++ V H E V C Sbjct: 26 CSLCLEQYQDPRVLACLHTYCRHCLESLVEHSKECTVSC 64 >SB_39478| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 254 Score = 33.9 bits (74), Expect = 0.13 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = +3 Query: 141 SHNMEYDCAVCLQKCQHPTKLSCGHVFCFLCV 236 S N ++C +CL + CGH+FC+ C+ Sbjct: 56 SANANFECNICLDTARDAVISMCGHLFCWPCL 87 >SB_39287| Best HMM Match : NHL (HMM E-Value=1.5e-21) Length = 645 Score = 33.9 bits (74), Expect = 0.13 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +3 Query: 153 EYDCAVCLQKCQHPTKLSCGHVFCFLCVK 239 E C+VCL++ + P L C H FC C++ Sbjct: 19 ELTCSVCLEQFREPKMLPCFHTFCKECLE 47 >SB_30389| Best HMM Match : Helicase_C (HMM E-Value=3.3e-21) Length = 380 Score = 33.9 bits (74), Expect = 0.13 Identities = 12/44 (27%), Positives = 21/44 (47%) Frame = +3 Query: 114 VLKHAVLIFSHNMEYDCAVCLQKCQHPTKLSCGHVFCFLCVKGV 245 ++ + + S + +C +CL P+ C HVFC C+ V Sbjct: 49 LINQLLQVLSSGVSEECPICLDPLDDPSITRCAHVFCTGCLTDV 92 >SB_27080| Best HMM Match : zf-C3HC4 (HMM E-Value=8.1e-10) Length = 462 Score = 33.9 bits (74), Expect = 0.13 Identities = 15/39 (38%), Positives = 23/39 (58%), Gaps = 2/39 (5%) Frame = +3 Query: 162 CAVCLQKCQHPTKLSCGHVFCFLCVKG-VAH-QAENVQC 272 C++CL++ Q P L+C H +C C++ V H Q V C Sbjct: 17 CSLCLEQYQDPRVLACLHTYCRHCLESLVEHSQERTVSC 55 >SB_54221| Best HMM Match : zf-B_box (HMM E-Value=2.1e-17) Length = 455 Score = 33.5 bits (73), Expect = 0.17 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +3 Query: 153 EYDCAVCLQKCQHPTKLSCGHVFCFLCVKGVAHQAE 260 E C++C++ P L C H FC C++ +A +E Sbjct: 12 EVTCSICIEHFNDPRVLPCFHSFCLHCLEELAVHSE 47 >SB_13725| Best HMM Match : zf-B_box (HMM E-Value=6e-14) Length = 594 Score = 33.5 bits (73), Expect = 0.17 Identities = 15/39 (38%), Positives = 22/39 (56%), Gaps = 2/39 (5%) Frame = +3 Query: 162 CAVCLQKCQHPTKLSCGHVFCFLCVKG-VAHQAE-NVQC 272 C +CL++ Q P L+C H +C C++ V H E V C Sbjct: 16 CCLCLEQYQDPRVLACLHTYCRHCLESLVEHSKECTVSC 54 >SB_5526| Best HMM Match : zf-C3HC4 (HMM E-Value=2) Length = 106 Score = 33.5 bits (73), Expect = 0.17 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = +3 Query: 156 YDCAVCLQKCQHPTKLSCGHVFCFLCVK 239 + C++C + P + +C HVFC+ C+K Sbjct: 79 HQCSICSEPPTAPHQGACEHVFCYYCIK 106 >SB_35560| Best HMM Match : zf-B_box (HMM E-Value=1e-20) Length = 470 Score = 33.1 bits (72), Expect = 0.22 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +3 Query: 153 EYDCAVCLQKCQHPTKLSCGHVFCFLCVKGVAHQA 257 E CA+C++ P L C H FC C++ +A + Sbjct: 12 EVTCAICIEHFTDPRLLPCLHTFCRHCLEDLAEHS 46 >SB_19774| Best HMM Match : WWE (HMM E-Value=5.4e-24) Length = 729 Score = 32.7 bits (71), Expect = 0.29 Identities = 32/103 (31%), Positives = 43/103 (41%), Gaps = 5/103 (4%) Frame = +2 Query: 299 FENPVLLDKSNLQYAANVDGVEGFQWYYEGRNGWWKYDERSNSELENAFNNGESECTLLL 478 F LL+KS L+ + +QW + R W Y +E AF +GE E +L Sbjct: 78 FSVDALLNKSQLRTEHGL-----WQWR-DDRGTWHSYSWIDCKIIEAAFQSGEDELSLST 131 Query: 479 AGTLYIVDFQ--Q*LN---SVEVIILAAAGAKEYPPVTCQRNS 592 G Y +DF Q +N I AGA E +T Q S Sbjct: 132 MGRSYTIDFNALQQINEDTGTTRPIQRCAGAGESTSLTLQSGS 174 >SB_46701| Best HMM Match : zf-B_box (HMM E-Value=1.4e-17) Length = 442 Score = 32.3 bits (70), Expect = 0.39 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +3 Query: 153 EYDCAVCLQKCQHPTKLSCGHVFCFLCVKGVAHQAE 260 E C++C++ P L C H FC C++ +A +E Sbjct: 12 EVTCSICIEHFNDPRVLPCFHSFCRHCLEELAVHSE 47 >SB_37011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1829 Score = 32.3 bits (70), Expect = 0.39 Identities = 15/39 (38%), Positives = 22/39 (56%), Gaps = 2/39 (5%) Frame = +3 Query: 162 CAVCLQKCQHPTKLSCGHVFCFLCVKG-VAHQAE-NVQC 272 C++CL + Q P L+C H +C C++ V H E V C Sbjct: 17 CSLCLGQYQDPRVLACLHTYCRHCLESLVEHSKECTVSC 55 >SB_21628| Best HMM Match : zf-B_box (HMM E-Value=1.4e-17) Length = 291 Score = 32.3 bits (70), Expect = 0.39 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +3 Query: 153 EYDCAVCLQKCQHPTKLSCGHVFCFLCVKGVAHQAE 260 E C++C++ P L C H FC C++ +A +E Sbjct: 12 EVTCSICIEHFNDPRVLPCFHSFCRHCLEELAVHSE 47 >SB_6628| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-09) Length = 89 Score = 32.3 bits (70), Expect = 0.39 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +3 Query: 153 EYDCAVCLQKCQHPTKLSCGHVFCFLCVKGVAHQAE 260 E C++C++ P L C H FC C++ +A +E Sbjct: 12 EVTCSICIEHFNDPRVLPCFHSFCRHCLEELAVHSE 47 >SB_51226| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-09) Length = 82 Score = 32.3 bits (70), Expect = 0.39 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +3 Query: 153 EYDCAVCLQKCQHPTKLSCGHVFCFLCVKGVAHQAE 260 E C++C++ P L C H FC C++ +A +E Sbjct: 12 EVTCSICIEHFNDPRVLPCFHSFCRHCLEELAVHSE 47 >SB_47995| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-09) Length = 745 Score = 32.3 bits (70), Expect = 0.39 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +3 Query: 153 EYDCAVCLQKCQHPTKLSCGHVFCFLCVKGVAHQAE 260 E C++C++ P L C H FC C++ +A +E Sbjct: 12 EVTCSICIEHFNDPRVLPCFHSFCRHCLEELAVHSE 47 >SB_43880| Best HMM Match : zf-B_box (HMM E-Value=5.1e-15) Length = 405 Score = 32.3 bits (70), Expect = 0.39 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +3 Query: 153 EYDCAVCLQKCQHPTKLSCGHVFCFLCVKGVAHQAE 260 E C++C++ P L C H FC C++ +A +E Sbjct: 11 EVTCSICIEHFNDPRVLPCFHSFCRHCLEELAVHSE 46 >SB_6802| Best HMM Match : zf-B_box (HMM E-Value=5e-18) Length = 316 Score = 32.3 bits (70), Expect = 0.39 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +3 Query: 153 EYDCAVCLQKCQHPTKLSCGHVFCFLCVKGVAHQAE 260 E C++C++ P L C H FC C++ +A +E Sbjct: 12 EVTCSICIEHLNDPRVLPCLHSFCRHCLEELAVHSE 47 >SB_28248| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-10) Length = 119 Score = 31.9 bits (69), Expect = 0.51 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +3 Query: 153 EYDCAVCLQKCQHPTKLSCGHVFCFLCVKGVAHQAE 260 E C++C++ P L C H FC C++ +A +E Sbjct: 12 EVTCSICIEHFNDPRVLPCLHSFCRHCLEELAVHSE 47 >SB_26592| Best HMM Match : zf-B_box (HMM E-Value=1.3e-18) Length = 355 Score = 31.9 bits (69), Expect = 0.51 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +3 Query: 153 EYDCAVCLQKCQHPTKLSCGHVFCFLCVKGVAHQAE 260 E C++C++ P L C H FC C++ +A +E Sbjct: 12 EVRCSICIEHFNDPRVLPCFHSFCRHCLEELAVHSE 47 >SB_20056| Best HMM Match : zf-C3HC4 (HMM E-Value=9e-11) Length = 471 Score = 31.9 bits (69), Expect = 0.51 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = +3 Query: 156 YDCAVCLQKCQHPTKLSCGHVFCFLCVK 239 ++C +C P + CGH +C C+K Sbjct: 20 FECGLCGDFYVDPVTILCGHTYCLACIK 47 Score = 31.1 bits (67), Expect = 0.90 Identities = 13/43 (30%), Positives = 21/43 (48%), Gaps = 1/43 (2%) Frame = +3 Query: 153 EYDCAVCLQKCQHPTKLSCGHVFCFLCV-KGVAHQAENVQCVA 278 +++C +C P CGH FC C+ + + H+ E C A Sbjct: 327 DFECKLCFNLLLEPVTSLCGHSFCRDCLYRSLDHRVECPCCRA 369 >SB_7987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 466 Score = 31.9 bits (69), Expect = 0.51 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +3 Query: 162 CAVCLQKCQHPTKLSCGHVFCFLCV 236 CA+C + P C H FC LC+ Sbjct: 160 CAICKEVLTQPIATPCDHYFCVLCI 184 >SB_6888| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1257 Score = 31.9 bits (69), Expect = 0.51 Identities = 12/26 (46%), Positives = 18/26 (69%), Gaps = 1/26 (3%) Frame = +3 Query: 162 CAVCLQKCQHPTKLS-CGHVFCFLCV 236 C +C + +PT LS CG+VFC+ C+ Sbjct: 1201 CPLCAKVRTNPTALSTCGYVFCYPCI 1226 >SB_57688| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-08) Length = 262 Score = 31.9 bits (69), Expect = 0.51 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +3 Query: 162 CAVCLQKCQHPTKLSCGHVFCFLCV 236 CA+C + P C H FC LC+ Sbjct: 34 CAICKEVLTQPIATPCDHYFCVLCI 58 >SB_56644| Best HMM Match : zf-C3HC4 (HMM E-Value=2.9e-07) Length = 858 Score = 31.9 bits (69), Expect = 0.51 Identities = 11/27 (40%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Frame = +3 Query: 159 DCAVCLQKCQHPTKLS-CGHVFCFLCV 236 +C +CL+ +P L CGH FC C+ Sbjct: 677 ECPICLETITYPETLQGCGHTFCRPCI 703 >SB_53640| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-10) Length = 62 Score = 31.9 bits (69), Expect = 0.51 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +3 Query: 153 EYDCAVCLQKCQHPTKLSCGHVFCFLCVKGVAHQAE 260 E C++C++ P L C H FC C++ +A +E Sbjct: 12 EVTCSICIEHFNDPRVLPCLHSFCRHCLEELAVHSE 47 >SB_48027| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-10) Length = 62 Score = 31.9 bits (69), Expect = 0.51 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +3 Query: 153 EYDCAVCLQKCQHPTKLSCGHVFCFLCVKGVAHQAE 260 E C++C++ P L C H FC C++ +A +E Sbjct: 12 EVTCSICIEHFNDPRVLPCLHSFCRHCLEELAVHSE 47 >SB_41431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 667 Score = 31.9 bits (69), Expect = 0.51 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +3 Query: 153 EYDCAVCLQKCQHPTKLSCGHVFCFLCVKGVAHQAE 260 E C++C++ P L C H FC C++ +A +E Sbjct: 17 EVTCSICIEHFDDPRVLPCLHSFCRHCLEELAVHSE 52 >SB_30107| Best HMM Match : zf-C3HC4 (HMM E-Value=2.9e-07) Length = 911 Score = 31.9 bits (69), Expect = 0.51 Identities = 11/27 (40%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Frame = +3 Query: 159 DCAVCLQKCQHPTKLS-CGHVFCFLCV 236 +C +CL+ +P L CGH FC C+ Sbjct: 752 ECPICLETITYPETLQGCGHTFCRPCI 778 >SB_30093| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-08) Length = 301 Score = 31.9 bits (69), Expect = 0.51 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +3 Query: 162 CAVCLQKCQHPTKLSCGHVFCFLCV 236 CA+C + P C H FC LC+ Sbjct: 160 CAICKEVLTQPIATPCDHYFCVLCI 184 >SB_22421| Best HMM Match : zf-B_box (HMM E-Value=4e-17) Length = 463 Score = 31.9 bits (69), Expect = 0.51 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +3 Query: 153 EYDCAVCLQKCQHPTKLSCGHVFCFLCVKGVAHQAE 260 E C++C++ P L C H FC C++ +A +E Sbjct: 12 EVTCSICIEHFNDPRVLPCLHSFCRHCLEELAVHSE 47 >SB_14063| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-08) Length = 301 Score = 31.9 bits (69), Expect = 0.51 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +3 Query: 162 CAVCLQKCQHPTKLSCGHVFCFLCV 236 CA+C + P C H FC LC+ Sbjct: 160 CAICKEVLTQPIATPCDHYFCVLCI 184 >SB_11572| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 888 Score = 31.9 bits (69), Expect = 0.51 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +3 Query: 153 EYDCAVCLQKCQHPTKLSCGHVFCFLCVKGVAHQAE 260 E C++C++ P L C H FC C++ +A +E Sbjct: 11 EVTCSICIEHFNDPRVLPCLHSFCRHCLEELAVHSE 46 >SB_24485| Best HMM Match : zf-CCCH (HMM E-Value=3e-09) Length = 321 Score = 31.5 bits (68), Expect = 0.68 Identities = 12/42 (28%), Positives = 21/42 (50%) Frame = +3 Query: 147 NMEYDCAVCLQKCQHPTKLSCGHVFCFLCVKGVAHQAENVQC 272 N+ + C +C + ++P C H FC C + H +N +C Sbjct: 240 NLPFACIMCRKTFKNPVVTKCLHYFCEAC--ALQHYKKNSKC 279 >SB_11151| Best HMM Match : Neur_chan_memb (HMM E-Value=3.6e-10) Length = 434 Score = 31.5 bits (68), Expect = 0.68 Identities = 12/27 (44%), Positives = 19/27 (70%) Frame = -3 Query: 219 KHDRRIVLLDVDIFASKQHSHIPYYVR 139 KH +RI+++D+DIFA K H Y++ Sbjct: 20 KHIKRIIVVDLDIFADKSPLHSSQYMK 46 >SB_4090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2342 Score = 31.5 bits (68), Expect = 0.68 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +3 Query: 153 EYDCAVCLQKCQHPTKLSCGHVFCFLCVKGVAHQAE 260 E C++C++ P L C H FC C++ +A +E Sbjct: 12 EVTCSLCIEHFNDPRVLPCFHSFCRHCLEELAVHSE 47 >SB_57762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 639 Score = 31.1 bits (67), Expect = 0.90 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +3 Query: 153 EYDCAVCLQKCQHPTKLSCGHVFCFLCVKGVAHQAE 260 E C++C++ P L C H FC C++ +A +E Sbjct: 12 EVTCSLCIEHFNDPRVLPCLHSFCRHCLEELAVHSE 47 >SB_18515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 391 Score = 31.1 bits (67), Expect = 0.90 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +3 Query: 153 EYDCAVCLQKCQHPTKLSCGHVFCFLCVKGVAHQAE 260 E C++C++ P L C H FC C++ +A +E Sbjct: 12 EVTCSLCIEHFNDPRVLPCLHSFCRHCLEELAVHSE 47 >SB_14518| Best HMM Match : MIB_HERC2 (HMM E-Value=2.4e-38) Length = 742 Score = 31.1 bits (67), Expect = 0.90 Identities = 13/40 (32%), Positives = 19/40 (47%) Frame = +2 Query: 167 CLLAKMSTSNKTILRSCFLFSLCEGCSSSSRKCAMCRTEI 286 C++ S + + + C CEGC S +KC CR I Sbjct: 625 CMVCSEKKS-QLLFKPCNHMVACEGCGSLMKKCIQCRENI 663 >SB_7188| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1094 Score = 31.1 bits (67), Expect = 0.90 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +3 Query: 153 EYDCAVCLQKCQHPTKLSCGHVFCFLC 233 E+ C+ C + HP CGHV C C Sbjct: 15 EFLCSYCRKVYLHPLVTGCGHVLCTKC 41 >SB_944| Best HMM Match : zf-B_box (HMM E-Value=6.7e-15) Length = 629 Score = 31.1 bits (67), Expect = 0.90 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +3 Query: 153 EYDCAVCLQKCQHPTKLSCGHVFCFLCVKGVAHQAE 260 E C++C++ P L C H FC C++ +A +E Sbjct: 132 EVTCSLCIEHFNDPRVLPCLHSFCRHCLEELAVHSE 167 >SB_43903| Best HMM Match : FHA (HMM E-Value=4.6e-13) Length = 553 Score = 31.1 bits (67), Expect = 0.90 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +3 Query: 153 EYDCAVCLQKCQHPTKLSCGHVFCFLCVK 239 E+ C VC + T L+C H FC C++ Sbjct: 368 EFSCIVCQELFIRATTLTCSHSFCEYCLQ 396 >SB_5620| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 937 Score = 31.1 bits (67), Expect = 0.90 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +3 Query: 162 CAVCLQKCQHPTKLSCGHVFCFLCVKGVA 248 C +CL + + P LSC H C C++ +A Sbjct: 21 CPICLDEFKEPKTLSCMHDLCRKCLEDMA 49 >SB_31692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 598 Score = 30.7 bits (66), Expect = 1.2 Identities = 11/30 (36%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Frame = +3 Query: 153 EYDCAVCLQKCQHPTKLS-CGHVFCFLCVK 239 EY+C +C + P ++ CGH FC C++ Sbjct: 23 EYECPICQLAFRDPIQIEECGHRFCQSCLQ 52 >SB_22639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 956 Score = 30.7 bits (66), Expect = 1.2 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +3 Query: 117 LKHAVLIFSHNMEYDCAVCLQKCQHPTKLSCGHVFCFLCV 236 L+ A ++ S E +C++C + P L C H FC C+ Sbjct: 83 LQMASILDSLRQEAECSLCHKTPSEPKILKCFHTFCNECL 122 >SB_4488| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 645 Score = 30.7 bits (66), Expect = 1.2 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +3 Query: 162 CAVCLQKCQHPTKLSCGHVFCFLCV 236 C +C + + P SCGH FC C+ Sbjct: 194 CPLCRRVFKDPVITSCGHTFCQACI 218 >SB_33568| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1555 Score = 30.3 bits (65), Expect = 1.6 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +3 Query: 162 CAVCLQKCQHPTKLSCGHVFCFLCVK 239 CA+C + P SCGH +C C++ Sbjct: 30 CAICHIVVKDPILTSCGHSYCKCCIQ 55 >SB_18762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 261 Score = 30.3 bits (65), Expect = 1.6 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = +3 Query: 147 NMEYDCAVCLQKCQHPTKLSCGHVFCFLC 233 N E+ CA+CL + P C H C C Sbjct: 20 NEEFHCAICLDVLEKPLSSKCQHSCCSDC 48 >SB_44886| Best HMM Match : zf-C3HC4 (HMM E-Value=1.3e-06) Length = 406 Score = 29.9 bits (64), Expect = 2.1 Identities = 11/36 (30%), Positives = 16/36 (44%) Frame = +3 Query: 132 LIFSHNMEYDCAVCLQKCQHPTKLSCGHVFCFLCVK 239 L+ H C C + + C HVFC+ C+K Sbjct: 344 LVLFHQARLTCPCCNTRKKDAILTKCFHVFCYECLK 379 >SB_50665| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 625 Score = 29.9 bits (64), Expect = 2.1 Identities = 12/36 (33%), Positives = 15/36 (41%) Frame = +3 Query: 153 EYDCAVCLQKCQHPTKLSCGHVFCFLCVKGVAHQAE 260 E+ CA+CL + P C H C C K E Sbjct: 165 EFHCAICLDVLEKPLSSKCQHSCCSDCWKSAFELGE 200 >SB_38753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 797 Score = 29.9 bits (64), Expect = 2.1 Identities = 12/36 (33%), Positives = 15/36 (41%) Frame = +3 Query: 153 EYDCAVCLQKCQHPTKLSCGHVFCFLCVKGVAHQAE 260 E+ CA+CL + P C H C C K E Sbjct: 73 EFHCAICLDVLEKPLSSKCQHSCCSDCWKSAFELGE 108 >SB_38368| Best HMM Match : zf-C3HC4 (HMM E-Value=4.4e-15) Length = 846 Score = 29.9 bits (64), Expect = 2.1 Identities = 12/36 (33%), Positives = 15/36 (41%) Frame = +3 Query: 153 EYDCAVCLQKCQHPTKLSCGHVFCFLCVKGVAHQAE 260 E+ CA+CL + P C H C C K E Sbjct: 313 EFHCAICLDVLEKPLSSKCQHSCCSDCWKSAFELGE 348 Score = 29.9 bits (64), Expect = 2.1 Identities = 12/36 (33%), Positives = 15/36 (41%) Frame = +3 Query: 153 EYDCAVCLQKCQHPTKLSCGHVFCFLCVKGVAHQAE 260 E+ CA+CL + P C H C C K E Sbjct: 639 EFHCAICLDVLEKPLSSKCQHSCCSDCWKSAFELGE 674 >SB_23299| Best HMM Match : zf-C3HC4 (HMM E-Value=5.9e-06) Length = 418 Score = 29.9 bits (64), Expect = 2.1 Identities = 12/36 (33%), Positives = 15/36 (41%) Frame = +3 Query: 153 EYDCAVCLQKCQHPTKLSCGHVFCFLCVKGVAHQAE 260 E+ CA+CL + P C H C C K E Sbjct: 171 EFHCAICLDVLEKPLSSKCQHSCCSDCWKSAFELGE 206 >SB_22842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 757 Score = 29.9 bits (64), Expect = 2.1 Identities = 12/36 (33%), Positives = 15/36 (41%) Frame = +3 Query: 153 EYDCAVCLQKCQHPTKLSCGHVFCFLCVKGVAHQAE 260 E+ CA+CL + P C H C C K E Sbjct: 316 EFHCAICLDVLEKPLSSKCQHSCCSDCWKSAFELGE 351 >SB_16517| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-07) Length = 306 Score = 29.9 bits (64), Expect = 2.1 Identities = 13/41 (31%), Positives = 20/41 (48%), Gaps = 2/41 (4%) Frame = +3 Query: 162 CAVCLQKCQHPTKLSCGHVFCFLCVKG--VAHQAENVQCVA 278 C +C + + CGH FC +C++ A EN +C A Sbjct: 18 CGICAEVLERAVLTPCGHSFCGVCLETWMNAKLEENEKCPA 58 >SB_37786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 434 Score = 29.5 bits (63), Expect = 2.7 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = +3 Query: 153 EYDCAVCLQKCQHPTKLSCGHVFCFLCVK 239 E+ CA+CL + P C H C C K Sbjct: 169 EFHCAICLDVLEKPLSSKCQHSCCSDCWK 197 >SB_19782| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 728 Score = 29.5 bits (63), Expect = 2.7 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = +3 Query: 162 CAVCLQKCQHPTKLSCGHVFCFLCVKGVAHQA 257 C++C + P L C HV+C C++ ++A Sbjct: 14 CSLCSEVLTEPKILRCFHVYCQKCLQAETNEA 45 >SB_20928| Best HMM Match : NHL (HMM E-Value=0) Length = 795 Score = 29.1 bits (62), Expect = 3.6 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = +3 Query: 162 CAVCLQKCQHPTKLSCGHVFCFLCVKGVAHQ 254 C C+ ++P L C H FC C+ H+ Sbjct: 15 CPKCMNAYENPKVLPCLHTFCSQCLSEELHR 45 >SB_7039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 577 Score = 29.1 bits (62), Expect = 3.6 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 183 CQHPTKLSCGHVFCFLCVKGVA 248 C H T CG FC+LC+K ++ Sbjct: 258 CNHMTCAVCGAEFCWLCMKEIS 279 >SB_37498| Best HMM Match : MATH (HMM E-Value=1.8e-28) Length = 562 Score = 29.1 bits (62), Expect = 3.6 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = +3 Query: 156 YDCAVCLQKCQHPTKLSCGHVFCFLC 233 + C +C Q P + +CGH C C Sbjct: 32 FRCTICKHVLQEPLQTTCGHRICESC 57 >SB_384| Best HMM Match : IBR (HMM E-Value=1.1e-12) Length = 259 Score = 29.1 bits (62), Expect = 3.6 Identities = 11/31 (35%), Positives = 20/31 (64%), Gaps = 3/31 (9%) Frame = +3 Query: 162 CAVCLQKCQHPTKLSCG---HVFCFLCVKGV 245 C V +Q+ + ++ CG H+FC+ C+KG+ Sbjct: 188 CQVLIQRDEGCAQMMCGNCKHIFCWHCLKGL 218 >SB_25082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 585 Score = 28.7 bits (61), Expect = 4.8 Identities = 13/37 (35%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = +3 Query: 147 NMEYDCAVCLQKCQHPTKLSCGHV-FCFLCVKGVAHQ 254 N C +CL+ ++ L+CGHV C C + + HQ Sbjct: 533 NQGTQCVICLENQRNVVLLNCGHVCSCRTCAQQI-HQ 568 >SB_47830| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 767 Score = 28.7 bits (61), Expect = 4.8 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +3 Query: 162 CAVCLQKCQHPTKLSCGHVFCFLCVK 239 C+ C ++P +L C H FC C+K Sbjct: 18 CSACKGFYKNPKRLPCLHAFCCHCLK 43 >SB_59028| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-05) Length = 362 Score = 28.3 bits (60), Expect = 6.3 Identities = 12/36 (33%), Positives = 14/36 (38%) Frame = +3 Query: 153 EYDCAVCLQKCQHPTKLSCGHVFCFLCVKGVAHQAE 260 E+ CA+CL P C H C C K E Sbjct: 115 EFHCAICLDVLGKPLSSKCQHSCCSDCWKSAFELGE 150 >SB_41147| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 332 Score = 28.3 bits (60), Expect = 6.3 Identities = 10/32 (31%), Positives = 17/32 (53%), Gaps = 1/32 (3%) Frame = +3 Query: 153 EYDCAVCLQKCQHPTKL-SCGHVFCFLCVKGV 245 +Y C +C + P + CGH FC C++ + Sbjct: 39 DYQCPICQLPFRDPVQTRDCGHRFCESCLEPI 70 >SB_37345| Best HMM Match : zf-B_box (HMM E-Value=1.3e-23) Length = 581 Score = 28.3 bits (60), Expect = 6.3 Identities = 12/43 (27%), Positives = 21/43 (48%), Gaps = 1/43 (2%) Frame = +3 Query: 147 NMEYDCAVCLQKCQHPTKLSCGHVFCFLCVKG-VAHQAENVQC 272 N+ C +C + +P L C H FC C++ V ++ + C Sbjct: 140 NVNLFCPLCHEMFANPRLLPCLHTFCKRCLENLVPPRSHTLSC 182 >SB_34455| Best HMM Match : Herpes_UL3 (HMM E-Value=1.8) Length = 328 Score = 28.3 bits (60), Expect = 6.3 Identities = 14/50 (28%), Positives = 22/50 (44%) Frame = +2 Query: 224 FSLCEGCSSSSRKCAMCRTEIPLDYFENPVLLDKSNLQYAANVDGVEGFQ 373 FS + C S+ +PL FE+P LL + + + VE F+ Sbjct: 146 FSRRKTCEILSKNAREFSDRLPLPVFEDPALLSSATKVTSGRTEAVESFR 195 >SB_29995| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-05) Length = 362 Score = 28.3 bits (60), Expect = 6.3 Identities = 12/36 (33%), Positives = 14/36 (38%) Frame = +3 Query: 153 EYDCAVCLQKCQHPTKLSCGHVFCFLCVKGVAHQAE 260 E+ CA+CL P C H C C K E Sbjct: 115 EFHCAICLDVLGKPLSSKCQHSCCSDCWKSAFELGE 150 >SB_24395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 887 Score = 28.3 bits (60), Expect = 6.3 Identities = 12/38 (31%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = +3 Query: 162 CAVCLQKCQHPTKLSCGHVFCFLCV-KGVAHQAENVQC 272 C +C + +P L C H FC C+ K + Q + C Sbjct: 17 CGICQETYNNPKVLPCLHSFCQNCLDKSIRSQERVLVC 54 >SB_19615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1376 Score = 28.3 bits (60), Expect = 6.3 Identities = 14/42 (33%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = -3 Query: 279 VRHIAHFLLDELHPSHKENRK-HDRRIVLLDVDIFASKQHSH 157 V +A FL + HKEN ++R + +L + +FA+ H H Sbjct: 1158 VESVAEFL-ERTREEHKENPDAYERNVCVLMIQLFAALDHLH 1198 >SB_16508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 514 Score = 28.3 bits (60), Expect = 6.3 Identities = 9/35 (25%), Positives = 19/35 (54%) Frame = +3 Query: 135 IFSHNMEYDCAVCLQKCQHPTKLSCGHVFCFLCVK 239 ++ + +C++C + + P L C H FC C++ Sbjct: 11 VYELSKHLNCSLCHRLIRGPKLLPCLHSFCLACLE 45 >SB_14081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 314 Score = 28.3 bits (60), Expect = 6.3 Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 3/52 (5%) Frame = +2 Query: 365 GFQWYYEGRNG-WWKYDERSNSELENAFNNGES--ECTLLLAGTLYIVDFQQ 511 GF W +EG G W YD + +LE A + S + + G IVDF++ Sbjct: 87 GFSWTWEGDYGDWISYDVTTACDLEKACDLQHSMLDLSSCAIGLPNIVDFRK 138 >SB_52478| Best HMM Match : NHL (HMM E-Value=1e-27) Length = 1387 Score = 28.3 bits (60), Expect = 6.3 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = +3 Query: 162 CAVCLQKCQHPTKLSCGHVFCFLCVKGV 245 C +C + + P L C H +C CVK + Sbjct: 659 CPICSRPFKSPKILPCLHTYCSDCVKEI 686 >SB_39493| Best HMM Match : zf-TRAF (HMM E-Value=1.5e-09) Length = 310 Score = 28.3 bits (60), Expect = 6.3 Identities = 9/27 (33%), Positives = 12/27 (44%) Frame = +3 Query: 162 CAVCLQKCQHPTKLSCGHVFCFLCVKG 242 C +C + P C H +C CV G Sbjct: 18 CCICRDVLEEPLMAPCEHSYCSACVLG 44 >SB_5773| Best HMM Match : HA2 (HMM E-Value=3e-16) Length = 2352 Score = 28.3 bits (60), Expect = 6.3 Identities = 11/26 (42%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Frame = +3 Query: 162 CAVCLQKCQHPTKLS-CGHVFCFLCV 236 C C + +P +L+ CGHV+C CV Sbjct: 1951 CPACFCEVDNPYQLATCGHVYCRGCV 1976 >SB_56142| Best HMM Match : zf-B_box (HMM E-Value=2.9e-10) Length = 691 Score = 27.9 bits (59), Expect = 8.4 Identities = 10/33 (30%), Positives = 16/33 (48%) Frame = +3 Query: 162 CAVCLQKCQHPTKLSCGHVFCFLCVKGVAHQAE 260 C +CL P L C H +C C++ + Q + Sbjct: 16 CLLCLDIFTDPRLLPCLHTYCKKCLEDLVSQCQ 48 >SB_38475| Best HMM Match : ASC (HMM E-Value=3.1e-14) Length = 421 Score = 27.9 bits (59), Expect = 8.4 Identities = 19/69 (27%), Positives = 34/69 (49%), Gaps = 1/69 (1%) Frame = +2 Query: 173 LAKMSTSNKTILRSCFLFSLCEGCSSSSRKCAMCRTEIPLD-YFENPVLLDKSNLQYAAN 349 L +ST + + + +F L SS+K ++ P+D Y + +L KS YA + Sbjct: 96 LFNLSTQDSNNIINGIIF-LMSAPRDSSQKSKF--SQFPIDNYTQRGPMLGKSLRSYAHS 152 Query: 350 VDGVEGFQW 376 +DG+ +W Sbjct: 153 IDGILSLKW 161 >SB_11435| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 618 Score = 27.9 bits (59), Expect = 8.4 Identities = 18/58 (31%), Positives = 24/58 (41%), Gaps = 3/58 (5%) Frame = +2 Query: 299 FENPVLLDKSNLQYAANVDGVEGFQ---WYYEGRNGWWKYDERSNSELENAFNNGESE 463 F LD S+ A G+ Q W+ R W K R+ S+ E A N+ E E Sbjct: 529 FSEQKYLDTSSRAKLAQTLGLNETQVKTWFQNRRMKWKKESNRNKSDAEEATNSTEGE 586 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,207,717 Number of Sequences: 59808 Number of extensions: 461678 Number of successful extensions: 1490 Number of sequences better than 10.0: 88 Number of HSP's better than 10.0 without gapping: 1310 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1482 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1829596184 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -