SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120039.Seq
         (672 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_26792| Best HMM Match : Herpes_BLRF2 (HMM E-Value=0.15)             31   0.64 
SB_47823| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   2.0  
SB_5523| Best HMM Match : Extensin_2 (HMM E-Value=0.0052)              30   2.0  
SB_18916| Best HMM Match : GPS (HMM E-Value=1e-17)                     29   2.6  
SB_49486| Best HMM Match : MARVEL (HMM E-Value=1.6)                    29   2.6  
SB_27802| Best HMM Match : Filament (HMM E-Value=0.2)                  28   7.9  

>SB_26792| Best HMM Match : Herpes_BLRF2 (HMM E-Value=0.15)
          Length = 221

 Score = 31.5 bits (68), Expect = 0.64
 Identities = 25/79 (31%), Positives = 43/79 (54%), Gaps = 1/79 (1%)
 Frame = +3

Query: 252 AKVPVTRAKKMPLRNQQFKQMGKFQQLRKKLKVQILVAPMMSHQNRHLSPTKQLKNLTLH 431
           A++     +++   N+  K+  KF++  KKL+  +  AP      + L    QL NL+LH
Sbjct: 23  AQMAYEEFRELTKENRHLKK--KFRECEKKLR-SMSTAPASGQIAKSLV---QLCNLSLH 76

Query: 432 QLRNKNHQMT-ATVMMMLR 485
            L+NK  Q++ +TV + LR
Sbjct: 77  LLKNKIRQVSISTVSLRLR 95


>SB_47823| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 671

 Score = 29.9 bits (64), Expect = 2.0
 Identities = 17/54 (31%), Positives = 30/54 (55%), Gaps = 5/54 (9%)
 Frame = +3

Query: 129 EKIDKSLAQTFMKKTKAKP-----RAKNQQTLLDIIAKFNQGNKAKAKVPVTRA 275
           EK +K +A+   ++T  +        K ++   DIIAKF++GN+ + KV   R+
Sbjct: 149 EKKNKEMARNDQQETTVETGMRGDNVKKEEIAEDIIAKFSEGNQVEEKVKKRRS 202


>SB_5523| Best HMM Match : Extensin_2 (HMM E-Value=0.0052)
          Length = 532

 Score = 29.9 bits (64), Expect = 2.0
 Identities = 15/45 (33%), Positives = 23/45 (51%), Gaps = 2/45 (4%)
 Frame = +3

Query: 327 QLRKKLKVQILVAPMMSHQNRHLSPTKQLKNLTLHQL--RNKNHQ 455
           Q RK  K  + + P   HQ  H++ T   K+LT H +  + + HQ
Sbjct: 92  QPRKHQKYHVTLTPPRKHQTYHVTLTPPRKHLTYHSMLTQPRKHQ 136



 Score = 29.9 bits (64), Expect = 2.0
 Identities = 13/33 (39%), Positives = 18/33 (54%)
 Frame = +3

Query: 333 RKKLKVQILVAPMMSHQNRHLSPTKQLKNLTLH 431
           RK L  Q+ + P   HQ  H++ T   K+LT H
Sbjct: 159 RKHLTYQVTLTPPRKHQTYHVTLTPPRKHLTYH 191



 Score = 29.9 bits (64), Expect = 2.0
 Identities = 15/45 (33%), Positives = 23/45 (51%), Gaps = 2/45 (4%)
 Frame = +3

Query: 327 QLRKKLKVQILVAPMMSHQNRHLSPTKQLKNLTLHQL--RNKNHQ 455
           Q RK  K  + + P   HQ  H++ T   K+LT H +  + + HQ
Sbjct: 300 QPRKHQKYHVTLTPPRKHQTYHVTLTPPRKHLTYHSMLTQPRKHQ 344



 Score = 29.9 bits (64), Expect = 2.0
 Identities = 16/49 (32%), Positives = 24/49 (48%), Gaps = 1/49 (2%)
 Frame = +3

Query: 333 RKKLKVQILVAPMMSHQNRHLSPTKQLKNLTLH-QLRNKNHQMTATVMM 476
           RK L   + + P   HQ  H++ T   K+LT H  L   +  +T  VM+
Sbjct: 445 RKHLTYHVTLTPPRKHQTYHVTLTPPRKHLTYHSMLTQPSKHLTYHVML 493



 Score = 29.5 bits (63), Expect = 2.6
 Identities = 17/52 (32%), Positives = 25/52 (48%), Gaps = 5/52 (9%)
 Frame = +3

Query: 327 QLRKKLKVQILVAPMMSHQNRHLSPTKQLKNLTLH-----QLRNKNHQMTAT 467
           Q RK     + + P   HQ  H+  T   K+LT H       +N+N+Q+T T
Sbjct: 339 QPRKHQTYHVTLTPPRKHQTYHVMLTPPRKHLTYHVTLTPPSKNQNYQVTLT 390



 Score = 29.1 bits (62), Expect = 3.4
 Identities = 14/43 (32%), Positives = 22/43 (51%), Gaps = 2/43 (4%)
 Frame = +3

Query: 333 RKKLKVQILVAPMMSHQNRHLSPTKQLKNLTLHQL--RNKNHQ 455
           RK L   + + P   HQ  H++ T   K+LT H +  + + HQ
Sbjct: 263 RKHLTYHVTLTPPRKHQTYHVTLTPPRKHLTYHSMLTQPRKHQ 305



 Score = 27.9 bits (59), Expect = 7.9
 Identities = 12/33 (36%), Positives = 17/33 (51%)
 Frame = +3

Query: 333 RKKLKVQILVAPMMSHQNRHLSPTKQLKNLTLH 431
           RK L   + + P   HQ  H++ T   K+LT H
Sbjct: 211 RKHLTYHVTLTPPRKHQTYHVTLTPPRKHLTYH 243



 Score = 27.9 bits (59), Expect = 7.9
 Identities = 12/33 (36%), Positives = 17/33 (51%)
 Frame = +3

Query: 333 RKKLKVQILVAPMMSHQNRHLSPTKQLKNLTLH 431
           RK L   + + P   HQ  H++ T   K+LT H
Sbjct: 237 RKHLTYHVTLTPPRKHQTYHVTLTPPRKHLTYH 269



 Score = 27.9 bits (59), Expect = 7.9
 Identities = 15/49 (30%), Positives = 24/49 (48%), Gaps = 5/49 (10%)
 Frame = +3

Query: 336 KKLKVQILVAPMMSHQNRHLSPTKQLKNLTLH-----QLRNKNHQMTAT 467
           K    Q+ + P   HQ  H+  T+  K+LT H       +N+N+ +T T
Sbjct: 381 KNQNYQVTLTPPHKHQTYHVMLTQPSKHLTYHVTLTPPSKNQNYHVTLT 429


>SB_18916| Best HMM Match : GPS (HMM E-Value=1e-17)
          Length = 1470

 Score = 29.5 bits (63), Expect = 2.6
 Identities = 22/83 (26%), Positives = 41/83 (49%), Gaps = 1/83 (1%)
 Frame = +3

Query: 135 IDKSLAQTFMKKTKAKPRAKNQQTLLDIIAKFNQGNKAKAKVPVTRAKKMPLRNQQFK-Q 311
           +++  A+T + KTKA+P   N+     ++A   Q +  +   PV+ A ++PL N Q    
Sbjct: 388 VNRPAAKTLISKTKAQPYQSNKPA--RVMANQRQSSVPR-PAPVSYAGRLPLVNTQTPYY 444

Query: 312 MGKFQQLRKKLKVQILVAPMMSH 380
             +  Q R +L  +    P +S+
Sbjct: 445 KWRAAQQRNRLAQKAAQQPKLSN 467


>SB_49486| Best HMM Match : MARVEL (HMM E-Value=1.6)
          Length = 260

 Score = 29.5 bits (63), Expect = 2.6
 Identities = 11/51 (21%), Positives = 26/51 (50%)
 Frame = -3

Query: 442 FLSWCNVKFFNCLVGLRCLFWWLIIGATRI*TFSFFLSCWNFPICLNCWFL 290
           +L  C    +  ++G+ CL W + +       +  +++ WNF + L+ +F+
Sbjct: 1   WLPLCAFAMYRLVIGIYCLAWMMFVETDEGYKWFLYINHWNF-LALSLYFI 50


>SB_27802| Best HMM Match : Filament (HMM E-Value=0.2)
          Length = 528

 Score = 27.9 bits (59), Expect = 7.9
 Identities = 18/51 (35%), Positives = 30/51 (58%)
 Frame = +3

Query: 51  ILDKNFKMNLTTEIQADVNSLVHQYLEKIDKSLAQTFMKKTKAKPRAKNQQ 203
           IL+   K + + ++  D N L+H+   K D SLA+  MK+ K K +AK ++
Sbjct: 124 ILELKNKHSDSIKLAEDTNRLLHEVQRKND-SLAKD-MKRVKEKLKAKEKE 172


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,705,853
Number of Sequences: 59808
Number of extensions: 249143
Number of successful extensions: 1033
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 914
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1023
length of database: 16,821,457
effective HSP length: 80
effective length of database: 12,036,817
effective search space used: 1721264831
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -