SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120027.Seq
         (774 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_2813| Best HMM Match : No HMM Matches (HMM E-Value=.)               31   0.78 
SB_42044| Best HMM Match : ubiquitin (HMM E-Value=1.2e-06)             31   1.4  
SB_35564| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   2.4  
SB_25851| Best HMM Match : Laminin_G_2 (HMM E-Value=0)                 29   4.2  
SB_34917| Best HMM Match : zf-C2H2 (HMM E-Value=3.9e-37)               29   4.2  
SB_3353| Best HMM Match : No HMM Matches (HMM E-Value=.)               29   4.2  
SB_54030| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   7.3  
SB_28947| Best HMM Match : Sugar_tr (HMM E-Value=2.1e-06)              28   7.3  

>SB_2813| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1362

 Score = 31.5 bits (68), Expect = 0.78
 Identities = 13/33 (39%), Positives = 17/33 (51%)
 Frame = -1

Query: 414  AWDCYNNSNSRWAVVYHKTLNSRCRTTLGTASE 316
            AW  YN + ++W VVY KT   + R  L    E
Sbjct: 1207 AWKIYNETKNKWYVVYTKTAEQKERWRLAFTEE 1239


>SB_42044| Best HMM Match : ubiquitin (HMM E-Value=1.2e-06)
          Length = 1425

 Score = 30.7 bits (66), Expect = 1.4
 Identities = 11/24 (45%), Positives = 15/24 (62%)
 Frame = -1

Query: 426 RLHPAWDCYNNSNSRWAVVYHKTL 355
           RLH  W C ++  S  A++YH TL
Sbjct: 800 RLHHTWSCLHHQYSSSAIMYHSTL 823


>SB_35564| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1028

 Score = 29.9 bits (64), Expect = 2.4
 Identities = 15/44 (34%), Positives = 21/44 (47%), Gaps = 1/44 (2%)
 Frame = +3

Query: 246 WRRTIVNNQTTMTQINFN-ASYTSAPTPSRASFDNGYSEFCDKQ 374
           WRR   N+Q+ +T+  FN A +            N Y  FCD+Q
Sbjct: 34  WRRNFRNSQSVVTKTWFNVAGFVQPDVIVSLLNGNDYDGFCDRQ 77


>SB_25851| Best HMM Match : Laminin_G_2 (HMM E-Value=0)
          Length = 683

 Score = 29.1 bits (62), Expect = 4.2
 Identities = 23/74 (31%), Positives = 32/74 (43%), Gaps = 2/74 (2%)
 Frame = +3

Query: 249 RRTIVNNQTTMTQINFNASYTSAPTPSR--ASFDNGYSEFCDKQQPNDYLNYYNNPTPDG 422
           RRT        TQ  ++ S+    + S+  A  DNG    C  ++  D + +   PTP G
Sbjct: 549 RRTRKTTPQPTTQY-YSTSHDPMTSQSKKTACGDNG----CTTEETMDTMGFIIPPTPTG 603

Query: 423 ADTVVSDSETAAAS 464
              V SD    AAS
Sbjct: 604 GHNVTSDKPVMAAS 617


>SB_34917| Best HMM Match : zf-C2H2 (HMM E-Value=3.9e-37)
          Length = 288

 Score = 29.1 bits (62), Expect = 4.2
 Identities = 12/32 (37%), Positives = 16/32 (50%)
 Frame = -2

Query: 125 TSFYTCEPHTRCPCDRTR*ACSWPSPSRIRDL 30
           TS+     HT C  D T  +C W +   IRD+
Sbjct: 19  TSYKLDTTHTSCKLDTTHTSCKWDTTRCIRDI 50


>SB_3353| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 320

 Score = 29.1 bits (62), Expect = 4.2
 Identities = 23/74 (31%), Positives = 32/74 (43%), Gaps = 2/74 (2%)
 Frame = +3

Query: 249 RRTIVNNQTTMTQINFNASYTSAPTPSR--ASFDNGYSEFCDKQQPNDYLNYYNNPTPDG 422
           RRT        TQ  ++ S+    + S+  A  DNG    C  ++  D + +   PTP G
Sbjct: 186 RRTRKTTPQPTTQY-YSTSHDPMTSQSKKTACGDNG----CTTEETMDTMGFIIPPTPTG 240

Query: 423 ADTVVSDSETAAAS 464
              V SD    AAS
Sbjct: 241 GHNVTSDKPVMAAS 254


>SB_54030| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 460

 Score = 28.3 bits (60), Expect = 7.3
 Identities = 16/56 (28%), Positives = 25/56 (44%)
 Frame = +3

Query: 342 DNGYSEFCDKQQPNDYLNYYNNPTPDGADTVVSDSETAAASNFLASVNSLTDDNDI 509
           DN  ++  D    ND +N  N+   D  D  ++D       N +   N + DDND+
Sbjct: 52  DNDMNDDNDMNDDND-MNDDNDMNDDNDDNDMNDDNDMNDDNDMNDDNDMNDDNDM 106


>SB_28947| Best HMM Match : Sugar_tr (HMM E-Value=2.1e-06)
          Length = 624

 Score = 28.3 bits (60), Expect = 7.3
 Identities = 11/25 (44%), Positives = 16/25 (64%)
 Frame = -1

Query: 681 FSSSCRWLVHTNRLLKRFRIISRTG 607
           F  S RWL+  NRL +  +++SR G
Sbjct: 190 FPESARWLIANNRLDEALQVLSRYG 214


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 24,059,965
Number of Sequences: 59808
Number of extensions: 504606
Number of successful extensions: 1594
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 1472
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1594
length of database: 16,821,457
effective HSP length: 81
effective length of database: 11,977,009
effective search space used: 2107953584
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -