SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120017.Seq
         (731 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_16838| Best HMM Match : TolA (HMM E-Value=2)                        31   1.3  
SB_21715| Best HMM Match : Serglycin (HMM E-Value=0.054)               30   2.2  
SB_48630| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   2.9  
SB_25956| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   2.9  
SB_47272| Best HMM Match : zf-CCHC (HMM E-Value=0.0048)                29   2.9  
SB_21529| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   2.9  
SB_30201| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.9  
SB_18707| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.9  
SB_13884| Best HMM Match : LRR_1 (HMM E-Value=6.3e-06)                 29   3.9  
SB_16515| Best HMM Match : Extensin_2 (HMM E-Value=0.12)               29   3.9  
SB_56618| Best HMM Match : DUF1213 (HMM E-Value=0.022)                 29   5.1  
SB_39538| Best HMM Match : VWA (HMM E-Value=0)                         29   5.1  
SB_38320| Best HMM Match : SSDP (HMM E-Value=0.34)                     29   5.1  
SB_59142| Best HMM Match : RVT_1 (HMM E-Value=2.5e-09)                 28   6.8  
SB_52004| Best HMM Match : rve (HMM E-Value=1.2e-16)                   28   6.8  
SB_49328| Best HMM Match : DUF1091 (HMM E-Value=1.6)                   28   6.8  
SB_48511| Best HMM Match : Ank (HMM E-Value=4.6e-20)                   28   6.8  
SB_43735| Best HMM Match : PHD (HMM E-Value=5.6e-06)                   28   6.8  
SB_41742| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   6.8  
SB_39020| Best HMM Match : zf-CCHC (HMM E-Value=0.0048)                28   6.8  
SB_34336| Best HMM Match : zf-CCHC (HMM E-Value=0.0048)                28   6.8  
SB_32984| Best HMM Match : zf-CCHC (HMM E-Value=0.0048)                28   6.8  
SB_32428| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   6.8  
SB_26129| Best HMM Match : RVT_1 (HMM E-Value=1.2e-27)                 28   6.8  
SB_21933| Best HMM Match : RVT_1 (HMM E-Value=9.1e-27)                 28   6.8  
SB_20467| Best HMM Match : zf-CCHC (HMM E-Value=0.0048)                28   6.8  
SB_3510| Best HMM Match : zf-CCHC (HMM E-Value=0.0048)                 28   6.8  
SB_1807| Best HMM Match : zf-CCHC (HMM E-Value=0.0048)                 28   6.8  
SB_54014| Best HMM Match : zf-CCHC (HMM E-Value=0.0048)                28   6.8  
SB_51857| Best HMM Match : zf-CCHC (HMM E-Value=0.0048)                28   6.8  
SB_49367| Best HMM Match : AAA (HMM E-Value=0)                         28   6.8  
SB_45059| Best HMM Match : zf-CCHC (HMM E-Value=0.0048)                28   6.8  
SB_41413| Best HMM Match : zf-CCHC (HMM E-Value=0.0048)                28   6.8  
SB_27583| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   6.8  
SB_25888| Best HMM Match : zf-CCHC (HMM E-Value=0.0048)                28   6.8  
SB_25665| Best HMM Match : TolA (HMM E-Value=1.7)                      28   6.8  
SB_19509| Best HMM Match : rve (HMM E-Value=5.4e-26)                   28   6.8  
SB_16379| Best HMM Match : zf-CCHC (HMM E-Value=0.0048)                28   6.8  
SB_11418| Best HMM Match : zf-CCHC (HMM E-Value=0.0048)                28   6.8  
SB_10464| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   6.8  
SB_7494| Best HMM Match : RVT_1 (HMM E-Value=4.6e-28)                  28   6.8  
SB_4571| Best HMM Match : No HMM Matches (HMM E-Value=.)               28   6.8  
SB_3197| Best HMM Match : No HMM Matches (HMM E-Value=.)               28   6.8  
SB_24| Best HMM Match : No HMM Matches (HMM E-Value=.)                 28   6.8  
SB_42661| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   9.0  
SB_33431| Best HMM Match : zf-CCHC (HMM E-Value=0.0048)                28   9.0  
SB_28158| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   9.0  
SB_7831| Best HMM Match : RNA_pol_Rpb1_7 (HMM E-Value=0)               28   9.0  
SB_6246| Best HMM Match : No HMM Matches (HMM E-Value=.)               28   9.0  
SB_5839| Best HMM Match : No HMM Matches (HMM E-Value=.)               28   9.0  
SB_31885| Best HMM Match : RVT_1 (HMM E-Value=4.6e-28)                 28   9.0  
SB_17421| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   9.0  
SB_6709| Best HMM Match : PCNA_C (HMM E-Value=9.8)                     28   9.0  

>SB_16838| Best HMM Match : TolA (HMM E-Value=2)
          Length = 371

 Score = 30.7 bits (66), Expect = 1.3
 Identities = 19/57 (33%), Positives = 29/57 (50%), Gaps = 1/57 (1%)
 Frame = +3

Query: 69  SGNGHIHQRANLQQRARVRAAYDARQQNGHEPQQQ-HKLGSDRTVQQEQRTDARRRR 236
           S N  + Q+   QQ+ R    YD +QQ   + QQQ  +    +  QQEQ+   ++RR
Sbjct: 32  SNNVQLQQQKRQQQQKRTYN-YDIQQQQKRQQQQQKRQQQKQKRQQQEQKLQQQQRR 87



 Score = 28.7 bits (61), Expect = 5.1
 Identities = 14/44 (31%), Positives = 23/44 (52%)
 Frame = +3

Query: 105 QQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTDARRRR 236
           QQ+ R +     +QQ     QQ+ KL   +  QQ+Q+   ++RR
Sbjct: 56  QQQKRQQQQQKRQQQKQKRQQQEQKLQQQQRRQQQQKRQPQQRR 99


>SB_21715| Best HMM Match : Serglycin (HMM E-Value=0.054)
          Length = 1079

 Score = 29.9 bits (64), Expect = 2.2
 Identities = 15/54 (27%), Positives = 26/54 (48%), Gaps = 1/54 (1%)
 Frame = +3

Query: 81  HIHQRANLQQRARVRAAYDARQQNGHEPQQQHKLGSD-RTVQQEQRTDARRRRI 239
           H H R+   +R R    + A+   GH  ++  K  +D  T+++    DAR+  I
Sbjct: 651 HHHHRSKKDRRHRNTKTHHAKHLKGHSARKHRKENNDAETLEEAVEKDARKNDI 704


>SB_48630| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 228

 Score = 29.5 bits (63), Expect = 2.9
 Identities = 10/23 (43%), Positives = 15/23 (65%)
 Frame = +1

Query: 31  YNTPPPPLRYPSNPATAIFTNAQ 99
           YNT PPPL +P++P    ++  Q
Sbjct: 58  YNTYPPPLSHPNDPTRGFYSPVQ 80


>SB_25956| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1146

 Score = 29.5 bits (63), Expect = 2.9
 Identities = 23/75 (30%), Positives = 34/75 (45%), Gaps = 1/75 (1%)
 Frame = +3

Query: 33   QHPSAAAEVSL*SGNGHIHQRANLQQRARVRAAYDARQQNGHEPQQQH-KLGSDRTVQQE 209
            QHPS   E        H  Q+ N  Q+ +        QQ  H+ QQQH +    R  QQ+
Sbjct: 1064 QHPSEQ-ETDHEQPAQHDQQQQNTGQQQQHDKQQQHDQQQQHDQQQQHDQQQQQRHDQQQ 1122

Query: 210  QRTDARRRRIYLVQQ 254
            Q  D ++++ +  QQ
Sbjct: 1123 QHHDQQQQQHHDQQQ 1137


>SB_47272| Best HMM Match : zf-CCHC (HMM E-Value=0.0048)
          Length = 737

 Score = 29.5 bits (63), Expect = 2.9
 Identities = 19/60 (31%), Positives = 32/60 (53%)
 Frame = +3

Query: 363 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAESLPSDSNIFQASLC*IRCRRTRK 542
           DT+  +VN V +FES++  I++  R  K+ GQG   ++     ++    LC  R +  RK
Sbjct: 430 DTSETDVNAVSKFESKKPNIKNYRR--KQRGQGKQCDNC-GYQHMANQELCPARGKDCRK 486


>SB_21529| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 367

 Score = 29.5 bits (63), Expect = 2.9
 Identities = 14/56 (25%), Positives = 30/56 (53%)
 Frame = +3

Query: 87  HQRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTDARRRRIYLVQQ 254
           HQ    QQ+ + +  +  + Q+ H+ QQQ +    +  QQ+Q+   ++++   +QQ
Sbjct: 294 HQLHQHQQQHQYQQQHQHQHQHQHQQQQQQQQQQQQQQQQQQQQQQQQQQQQQLQQ 349



 Score = 28.3 bits (60), Expect = 6.8
 Identities = 15/57 (26%), Positives = 30/57 (52%)
 Frame = +3

Query: 84  IHQRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTDARRRRIYLVQQ 254
           +HQ+  L Q  +    +  +QQ+ H+ Q QH+    +  QQ+Q+   ++++    QQ
Sbjct: 290 LHQQHQLHQHQQ---QHQYQQQHQHQHQHQHQQQQQQQQQQQQQQQQQQQQQQQQQQ 343


>SB_30201| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 177

 Score = 29.1 bits (62), Expect = 3.9
 Identities = 15/64 (23%), Positives = 32/64 (50%)
 Frame = +3

Query: 90  QRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTDARRRRIYLVQQCVDFV 269
           Q+  LQQ+   +     +Q    +PQQQ         QQ Q+   +++++ ++QQ +  +
Sbjct: 112 QQQQLQQQQPQQQQQQQQQPQQQQPQQQQLQQQQLQQQQLQQQQLQQQQMLMMQQFIGVM 171

Query: 270 QKII 281
            K++
Sbjct: 172 GKML 175


>SB_18707| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 176

 Score = 29.1 bits (62), Expect = 3.9
 Identities = 15/64 (23%), Positives = 32/64 (50%)
 Frame = +3

Query: 90  QRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTDARRRRIYLVQQCVDFV 269
           Q+  LQQ+   +     +Q    +PQQQ         QQ Q+   +++++ ++QQ +  +
Sbjct: 111 QQQQLQQQQPQQQQQQQQQPQQQQPQQQQLQQQQLQQQQLQQQQLQQQQMLMMQQFIGVM 170

Query: 270 QKII 281
            K++
Sbjct: 171 GKML 174


>SB_13884| Best HMM Match : LRR_1 (HMM E-Value=6.3e-06)
          Length = 575

 Score = 29.1 bits (62), Expect = 3.9
 Identities = 18/55 (32%), Positives = 28/55 (50%), Gaps = 1/55 (1%)
 Frame = +1

Query: 10  DERGNFYYNTPPPPLRYPSNPATAIFTNAQTYNNAPGYVPPTTRD-NKMDTSRSN 171
           +ERG  ++        +PS P TA FTN    +     V P +R+ N++  SRS+
Sbjct: 511 EERGYGHFIKTRTGDPHPSYPLTASFTNYPLLSTLDPLVAPLSRELNQLPASRSH 565


>SB_16515| Best HMM Match : Extensin_2 (HMM E-Value=0.12)
          Length = 917

 Score = 29.1 bits (62), Expect = 3.9
 Identities = 16/48 (33%), Positives = 23/48 (47%), Gaps = 1/48 (2%)
 Frame = +1

Query: 43  PPPLRYPSN-PATAIFTNAQTYNNAPGYVPPTTRDNKMDTSRSNSTNS 183
           PP  R+PS  P+     NA + +N P Y P    D+  D   S + +S
Sbjct: 550 PPEYRFPSEEPSPYAEENAISRSNPPVYTPKEEDDDDDDDEESETEDS 597


>SB_56618| Best HMM Match : DUF1213 (HMM E-Value=0.022)
          Length = 1421

 Score = 28.7 bits (61), Expect = 5.1
 Identities = 14/58 (24%), Positives = 27/58 (46%)
 Frame = +3

Query: 81  HIHQRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTDARRRRIYLVQQ 254
           H  QR    ++  + A    +QQ   + QQQ +    +  QQ+Q+   ++++    QQ
Sbjct: 112 HDDQRTEYDEKTNILAPQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ 169


>SB_39538| Best HMM Match : VWA (HMM E-Value=0)
          Length = 3208

 Score = 28.7 bits (61), Expect = 5.1
 Identities = 13/54 (24%), Positives = 29/54 (53%)
 Frame = +3

Query: 69   SGNGHIHQRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTDARR 230
            S N H+  R   ++++R+R   +A  +   +P+++ +L   R  +  ++T  RR
Sbjct: 3012 SRNDHVQSRFGAREKSRIRRGIEAILRGRTKPRRRRRLNKSRR-RTHKKTTLRR 3064


>SB_38320| Best HMM Match : SSDP (HMM E-Value=0.34)
          Length = 273

 Score = 28.7 bits (61), Expect = 5.1
 Identities = 14/50 (28%), Positives = 25/50 (50%)
 Frame = +3

Query: 90  QRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTDARRRRI 239
           Q+   QQ+ + +     +QQ   + QQQ +    +  Q +QRTD ++  I
Sbjct: 31  QQQQKQQQQQQQQQQKQQQQKQQQQQQQQQQQQQQQQQHQQRTDKKQTEI 80


>SB_59142| Best HMM Match : RVT_1 (HMM E-Value=2.5e-09)
          Length = 772

 Score = 28.3 bits (60), Expect = 6.8
 Identities = 14/38 (36%), Positives = 24/38 (63%)
 Frame = +3

Query: 363 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAES 476
           DT+  +VN V +FES++  I++  R  K+ GQG   ++
Sbjct: 184 DTSETDVNAVSKFESKKPNIKNYRR--KQRGQGKQCDN 219


>SB_52004| Best HMM Match : rve (HMM E-Value=1.2e-16)
          Length = 869

 Score = 28.3 bits (60), Expect = 6.8
 Identities = 14/38 (36%), Positives = 24/38 (63%)
 Frame = +3

Query: 363 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAES 476
           DT+  +VN V +FES++  I++  R  K+ GQG   ++
Sbjct: 184 DTSETDVNAVSKFESKKPNIKNYRR--KQRGQGKQCDN 219


>SB_49328| Best HMM Match : DUF1091 (HMM E-Value=1.6)
          Length = 555

 Score = 28.3 bits (60), Expect = 6.8
 Identities = 22/79 (27%), Positives = 30/79 (37%), Gaps = 3/79 (3%)
 Frame = -1

Query: 617 RPS*VVCPPRPKRLYPTYQRHRCKIFARTPAANLAQRC--LKYIRIARQGLGRVALSQLF 444
           +PS +   P P R YP +      +    P      RC  L Y +   +     +L QL 
Sbjct: 96  QPSRLNKQPIPSRFYPVFDEIGLTVAEYQPGTRWCYRCKLLAYKKFESRPQTSNSLGQLV 155

Query: 443 LQPNQVAYHGLLRFK-PLY 390
            Q     YH  L  + PLY
Sbjct: 156 QQFQMALYHHALSSEAPLY 174


>SB_48511| Best HMM Match : Ank (HMM E-Value=4.6e-20)
          Length = 753

 Score = 28.3 bits (60), Expect = 6.8
 Identities = 14/64 (21%), Positives = 34/64 (53%)
 Frame = +3

Query: 84  IHQRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTDARRRRIYLVQQCVD 263
           + +++ +Q++  V     +R+ +G +     ++ S RTVQ+E+R    + ++ L Q+   
Sbjct: 619 LSRKSAIQRKTPVLRVSSSRR-SGSQRGNSSRIASARTVQEEERAKVHQAKLQLKQKLAQ 677

Query: 264 FVQK 275
             +K
Sbjct: 678 DTKK 681


>SB_43735| Best HMM Match : PHD (HMM E-Value=5.6e-06)
          Length = 772

 Score = 28.3 bits (60), Expect = 6.8
 Identities = 14/38 (36%), Positives = 24/38 (63%)
 Frame = +3

Query: 363 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAES 476
           DT+  +VN V +FES++  I++  R  K+ GQG   ++
Sbjct: 184 DTSETDVNAVSKFESKKPNIKNYRR--KQRGQGKQCDN 219


>SB_41742| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1061

 Score = 28.3 bits (60), Expect = 6.8
 Identities = 14/38 (36%), Positives = 24/38 (63%)
 Frame = +3

Query: 363 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAES 476
           DT+  +VN V +FES++  I++  R  K+ GQG   ++
Sbjct: 184 DTSETDVNAVSKFESKKPNIKNYRR--KQRGQGKQCDN 219


>SB_39020| Best HMM Match : zf-CCHC (HMM E-Value=0.0048)
          Length = 319

 Score = 28.3 bits (60), Expect = 6.8
 Identities = 14/38 (36%), Positives = 24/38 (63%)
 Frame = +3

Query: 363 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAES 476
           DT+  +VN V +FES++  I++  R  K+ GQG   ++
Sbjct: 126 DTSETDVNAVSKFESKKPNIKNYRR--KQRGQGKQCDN 161


>SB_34336| Best HMM Match : zf-CCHC (HMM E-Value=0.0048)
          Length = 374

 Score = 28.3 bits (60), Expect = 6.8
 Identities = 14/38 (36%), Positives = 24/38 (63%)
 Frame = +3

Query: 363 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAES 476
           DT+  +VN V +FES++  I++  R  K+ GQG   ++
Sbjct: 10  DTSETDVNAVSKFESKKPNIKNYRR--KQRGQGKQCDN 45


>SB_32984| Best HMM Match : zf-CCHC (HMM E-Value=0.0048)
          Length = 361

 Score = 28.3 bits (60), Expect = 6.8
 Identities = 14/38 (36%), Positives = 24/38 (63%)
 Frame = +3

Query: 363 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAES 476
           DT+  +VN V +FES++  I++  R  K+ GQG   ++
Sbjct: 10  DTSETDVNAVSKFESKKPNIKNYRR--KQRGQGKQCDN 45


>SB_32428| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1128

 Score = 28.3 bits (60), Expect = 6.8
 Identities = 18/48 (37%), Positives = 20/48 (41%), Gaps = 1/48 (2%)
 Frame = -1

Query: 707 TESCNCWPA-AD*TVTEWECCTSPIPPPCTGRPS*VVCPPRPKRLYPT 567
           T++CN  PA  D  V      TS  PPP T  P     PP      PT
Sbjct: 89  TDNCNAKPAQPDTDVPPPPATTSAPPPPTTTAPPATTSPPTTTDSPPT 136


>SB_26129| Best HMM Match : RVT_1 (HMM E-Value=1.2e-27)
          Length = 1036

 Score = 28.3 bits (60), Expect = 6.8
 Identities = 14/38 (36%), Positives = 24/38 (63%)
 Frame = +3

Query: 363 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAES 476
           DT+  +VN V +FES++  I++  R  K+ GQG   ++
Sbjct: 184 DTSETDVNAVSKFESKKPNIKNYRR--KQRGQGKQCDN 219


>SB_21933| Best HMM Match : RVT_1 (HMM E-Value=9.1e-27)
          Length = 510

 Score = 28.3 bits (60), Expect = 6.8
 Identities = 14/38 (36%), Positives = 24/38 (63%)
 Frame = +3

Query: 363 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAES 476
           DT+  +VN V +FES++  I++  R  K+ GQG   ++
Sbjct: 10  DTSETDVNAVSKFESKKPNIKNYRR--KQRGQGKQCDN 45


>SB_20467| Best HMM Match : zf-CCHC (HMM E-Value=0.0048)
          Length = 317

 Score = 28.3 bits (60), Expect = 6.8
 Identities = 14/38 (36%), Positives = 24/38 (63%)
 Frame = +3

Query: 363 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAES 476
           DT+  +VN V +FES++  I++  R  K+ GQG   ++
Sbjct: 10  DTSETDVNAVSKFESKKPNIKNYRR--KQRGQGKQCDN 45


>SB_3510| Best HMM Match : zf-CCHC (HMM E-Value=0.0048)
          Length = 272

 Score = 28.3 bits (60), Expect = 6.8
 Identities = 14/38 (36%), Positives = 24/38 (63%)
 Frame = +3

Query: 363 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAES 476
           DT+  +VN V +FES++  I++  R  K+ GQG   ++
Sbjct: 130 DTSETDVNAVSKFESKKPNIKNYRR--KQRGQGKQCDN 165


>SB_1807| Best HMM Match : zf-CCHC (HMM E-Value=0.0048)
          Length = 281

 Score = 28.3 bits (60), Expect = 6.8
 Identities = 14/38 (36%), Positives = 24/38 (63%)
 Frame = +3

Query: 363 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAES 476
           DT+  +VN V +FES++  I++  R  K+ GQG   ++
Sbjct: 10  DTSETDVNAVSKFESKKPNIKNYRR--KQRGQGKQCDN 45


>SB_54014| Best HMM Match : zf-CCHC (HMM E-Value=0.0048)
          Length = 176

 Score = 28.3 bits (60), Expect = 6.8
 Identities = 14/38 (36%), Positives = 24/38 (63%)
 Frame = +3

Query: 363 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAES 476
           DT+  +VN V +FES++  I++  R  K+ GQG   ++
Sbjct: 10  DTSETDVNAVSKFESKKPNIKNYRR--KQRGQGKQCDN 45


>SB_51857| Best HMM Match : zf-CCHC (HMM E-Value=0.0048)
          Length = 438

 Score = 28.3 bits (60), Expect = 6.8
 Identities = 14/38 (36%), Positives = 24/38 (63%)
 Frame = +3

Query: 363 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAES 476
           DT+  +VN V +FES++  I++  R  K+ GQG   ++
Sbjct: 130 DTSETDVNAVSKFESKKPNIKNYRR--KQRGQGKQCDN 165


>SB_49367| Best HMM Match : AAA (HMM E-Value=0)
          Length = 976

 Score = 28.3 bits (60), Expect = 6.8
 Identities = 14/38 (36%), Positives = 24/38 (63%)
 Frame = +3

Query: 363 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAES 476
           DT+  +VN V +FES++  I++  R  K+ GQG   ++
Sbjct: 10  DTSETDVNAVSKFESKKPNIKNYRR--KQRGQGKQCDN 45


>SB_45059| Best HMM Match : zf-CCHC (HMM E-Value=0.0048)
          Length = 519

 Score = 28.3 bits (60), Expect = 6.8
 Identities = 14/38 (36%), Positives = 24/38 (63%)
 Frame = +3

Query: 363 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAES 476
           DT+  +VN V +FES++  I++  R  K+ GQG   ++
Sbjct: 184 DTSETDVNAVSKFESKKPNIKNYRR--KQRGQGKQCDN 219


>SB_41413| Best HMM Match : zf-CCHC (HMM E-Value=0.0048)
          Length = 471

 Score = 28.3 bits (60), Expect = 6.8
 Identities = 14/38 (36%), Positives = 24/38 (63%)
 Frame = +3

Query: 363 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAES 476
           DT+  +VN V +FES++  I++  R  K+ GQG   ++
Sbjct: 160 DTSETDVNAVSKFESKKPNIKNYRR--KQRGQGKQCDN 195


>SB_27583| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 515

 Score = 28.3 bits (60), Expect = 6.8
 Identities = 14/38 (36%), Positives = 24/38 (63%)
 Frame = +3

Query: 363 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAES 476
           DT+  +VN V +FES++  I++  R  K+ GQG   ++
Sbjct: 184 DTSETDVNAVSKFESKKPNIKNYRR--KQRGQGKQCDN 219


>SB_25888| Best HMM Match : zf-CCHC (HMM E-Value=0.0048)
          Length = 606

 Score = 28.3 bits (60), Expect = 6.8
 Identities = 14/38 (36%), Positives = 24/38 (63%)
 Frame = +3

Query: 363 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAES 476
           DT+  +VN V +FES++  I++  R  K+ GQG   ++
Sbjct: 184 DTSETDVNAVSKFESKKPNIKNYRR--KQRGQGKQCDN 219


>SB_25665| Best HMM Match : TolA (HMM E-Value=1.7)
          Length = 697

 Score = 28.3 bits (60), Expect = 6.8
 Identities = 19/55 (34%), Positives = 27/55 (49%)
 Frame = +3

Query: 90  QRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTDARRRRIYLVQQ 254
           Q+   QQR + R     RQQ  H  QQQ +    +  QQ+Q+   R++   L QQ
Sbjct: 253 QQQQQQQRLQQRRQLRERQQR-HLQQQQQRQQQFQRQQQQQQMQQRQQLQQLQQQ 306


>SB_19509| Best HMM Match : rve (HMM E-Value=5.4e-26)
          Length = 1195

 Score = 28.3 bits (60), Expect = 6.8
 Identities = 14/38 (36%), Positives = 24/38 (63%)
 Frame = +3

Query: 363 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAES 476
           DT+  +VN V +FES++  I++  R  K+ GQG   ++
Sbjct: 130 DTSETDVNAVSKFESKKPNIKNYRR--KQRGQGKQCDN 165


>SB_16379| Best HMM Match : zf-CCHC (HMM E-Value=0.0048)
          Length = 499

 Score = 28.3 bits (60), Expect = 6.8
 Identities = 14/38 (36%), Positives = 24/38 (63%)
 Frame = +3

Query: 363 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAES 476
           DT+  +VN V +FES++  I++  R  K+ GQG   ++
Sbjct: 77  DTSETDVNAVSKFESKKPNIKNYRR--KQRGQGKQCDN 112


>SB_11418| Best HMM Match : zf-CCHC (HMM E-Value=0.0048)
          Length = 292

 Score = 28.3 bits (60), Expect = 6.8
 Identities = 14/38 (36%), Positives = 24/38 (63%)
 Frame = +3

Query: 363 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAES 476
           DT+  +VN V +FES++  I++  R  K+ GQG   ++
Sbjct: 80  DTSETDVNAVSKFESKKPNIKNYRR--KQRGQGKQCDN 115


>SB_10464| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 476

 Score = 28.3 bits (60), Expect = 6.8
 Identities = 14/38 (36%), Positives = 24/38 (63%)
 Frame = +3

Query: 363 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAES 476
           DT+  +VN V +FES++  I++  R  K+ GQG   ++
Sbjct: 10  DTSETDVNAVSKFESKKPNIKNYRR--KQRGQGKQCDN 45


>SB_7494| Best HMM Match : RVT_1 (HMM E-Value=4.6e-28)
          Length = 960

 Score = 28.3 bits (60), Expect = 6.8
 Identities = 14/38 (36%), Positives = 24/38 (63%)
 Frame = +3

Query: 363 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAES 476
           DT+  +VN V +FES++  I++  R  K+ GQG   ++
Sbjct: 184 DTSETDVNAVSKFESKKPNIKNYRR--KQRGQGKQCDN 219


>SB_4571| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 737

 Score = 28.3 bits (60), Expect = 6.8
 Identities = 14/38 (36%), Positives = 24/38 (63%)
 Frame = +3

Query: 363 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAES 476
           DT+  +VN V +FES++  I++  R  K+ GQG   ++
Sbjct: 635 DTSETDVNAVSKFESKKPNIKNYRR--KQRGQGKQCDN 670


>SB_3197| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 652

 Score = 28.3 bits (60), Expect = 6.8
 Identities = 14/38 (36%), Positives = 24/38 (63%)
 Frame = +3

Query: 363 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAES 476
           DT+  +VN V +FES++  I++  R  K+ GQG   ++
Sbjct: 184 DTSETDVNAVSKFESKKPNIKNYRR--KQRGQGKQCDN 219


>SB_24| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1246

 Score = 28.3 bits (60), Expect = 6.8
 Identities = 14/38 (36%), Positives = 24/38 (63%)
 Frame = +3

Query: 363 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAES 476
           DT+  +VN V +FES++  I++  R  K+ GQG   ++
Sbjct: 184 DTSETDVNAVSKFESKKPNIKNYRR--KQRGQGKQCDN 219


>SB_42661| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1717

 Score = 27.9 bits (59), Expect = 9.0
 Identities = 15/55 (27%), Positives = 26/55 (47%), Gaps = 1/55 (1%)
 Frame = -1

Query: 704  ESCNCWPA-AD*TVTEWECCTSPIPPPCTGRPS*VVCPPRPKRLYPTYQRHRCKI 543
            + C C+P  A     + +C   P  PPC+G+       PR  + +P +   +C+I
Sbjct: 1573 QKCECYPGWAGDACDKLDC---PGSPPCSGQGECSNTNPRRCQCFPKWGGEKCEI 1624


>SB_33431| Best HMM Match : zf-CCHC (HMM E-Value=0.0048)
          Length = 377

 Score = 27.9 bits (59), Expect = 9.0
 Identities = 14/38 (36%), Positives = 23/38 (60%)
 Frame = +3

Query: 363 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAES 476
           DT+   VN V +FES++  I++  R  K+ GQG   ++
Sbjct: 184 DTSETGVNAVSKFESKKPNIKNYRR--KQRGQGKQCDN 219


>SB_28158| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 256

 Score = 27.9 bits (59), Expect = 9.0
 Identities = 14/52 (26%), Positives = 27/52 (51%), Gaps = 1/52 (1%)
 Frame = +1

Query: 61  PSNPATAIFTNA-QTYNNAPGYVPPTTRDNKMDTSRSNSTNSVAIAPYNKSK 213
           P++  T  F N+   + N   + P + RDN +DTS ++    +  +  NK++
Sbjct: 132 PNDNNTLSFDNSFNPFRNKSTWTPSSGRDNSLDTSPNSVKLQIQNSTLNKTR 183


>SB_7831| Best HMM Match : RNA_pol_Rpb1_7 (HMM E-Value=0)
          Length = 1467

 Score = 27.9 bits (59), Expect = 9.0
 Identities = 17/62 (27%), Positives = 29/62 (46%)
 Frame = +1

Query: 37  TPPPPLRYPSNPATAIFTNAQTYNNAPGYVPPTTRDNKMDTSRSNSTNSVAIAPYNKSKE 216
           +P  P   PS+P+ +  + + +   +PGY P +        S S S  S + +P + S  
Sbjct: 413 SPSSPAFMPSSPSMSPASPSYS-PTSPGYSPSSPSSGYSPASPSYSPTSPSYSPTSPSYS 471

Query: 217 PT 222
           PT
Sbjct: 472 PT 473


>SB_6246| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 135

 Score = 27.9 bits (59), Expect = 9.0
 Identities = 17/84 (20%), Positives = 44/84 (52%), Gaps = 3/84 (3%)
 Frame = +3

Query: 159 EPQQQHKLGSDRTVQQEQRTDARRRRIYLVQQCVDFVQKIIRYYRCN-DMSELSPLMI-- 329
           E   +HK+ ++  +++ +  D  RRRI  +   ++ ++K +   R +  +++L  L++  
Sbjct: 48  EESSKHKITAEARLRRLRANDRERRRIQSINVALEALRKAVPNTRSSGKLTKLDTLLLAR 107

Query: 330 HFINTIRDMCIDTNPINVNVVKRF 401
            +I  + ++   T   N++  K+F
Sbjct: 108 DYIKHLNEILQRTRDENLDRNKKF 131


>SB_5839| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 778

 Score = 27.9 bits (59), Expect = 9.0
 Identities = 14/55 (25%), Positives = 29/55 (52%)
 Frame = +3

Query: 90  QRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTDARRRRIYLVQQ 254
           Q+   QQ+ + +     +QQ   +PQQQ +   ++  QQ+Q+   ++++    QQ
Sbjct: 20  QQQQQQQQQQQQQQQQQQQQQQPQPQQQQQQQQEQEQQQQQQQQQQQQQQQQQQQ 74


>SB_31885| Best HMM Match : RVT_1 (HMM E-Value=4.6e-28)
          Length = 922

 Score = 27.9 bits (59), Expect = 9.0
 Identities = 14/38 (36%), Positives = 23/38 (60%)
 Frame = +3

Query: 363 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAES 476
           DT+   VN V +FES++  I++  R  K+ GQG   ++
Sbjct: 184 DTSETGVNAVSKFESKKPNIKNYRR--KQRGQGKQCDN 219


>SB_17421| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 555

 Score = 27.9 bits (59), Expect = 9.0
 Identities = 17/50 (34%), Positives = 26/50 (52%)
 Frame = -1

Query: 356 HVTNSVYKMNHERTKF*HVIAPVISNNFLNKIHTLLYQIDSPASSVGSLL 207
           HV   V+  N     F ++IA   +  + N++ TL+ QID P   +GS L
Sbjct: 494 HVDQIVHFRNF--VGFDYLIAFAYAALYANQLATLIMQIDEPTLKIGSQL 541


>SB_6709| Best HMM Match : PCNA_C (HMM E-Value=9.8)
          Length = 279

 Score = 27.9 bits (59), Expect = 9.0
 Identities = 16/54 (29%), Positives = 25/54 (46%)
 Frame = +1

Query: 46  PPLRYPSNPATAIFTNAQTYNNAPGYVPPTTRDNKMDTSRSNSTNSVAIAPYNK 207
           PP  +  +P +    N   +++ P Y PP   D +  T RS S  +V  A Y +
Sbjct: 144 PPSSHSRSPNSPGSPNPTLFSH-PSYYPPPPLDFQAGTKRSASCMAVVEADYGR 196


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 23,097,473
Number of Sequences: 59808
Number of extensions: 502548
Number of successful extensions: 2361
Number of sequences better than 10.0: 53
Number of HSP's better than 10.0 without gapping: 1821
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2207
length of database: 16,821,457
effective HSP length: 80
effective length of database: 12,036,817
effective search space used: 1962001171
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -