SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120012.Seq
         (701 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_41459| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   0.90 
SB_21034| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   4.8  
SB_42042| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   8.4  
SB_10656| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   8.4  

>SB_41459| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1675

 Score = 31.1 bits (67), Expect = 0.90
 Identities = 15/39 (38%), Positives = 23/39 (58%)
 Frame = -2

Query: 283 IALLCHAVWSEGGSLAPDSLYVYLYFLSTCLLTASLQFP 167
           + L  +A WS   S+  +SLY YL+ L + ++ ASL  P
Sbjct: 114 VDLPIYAKWSRRRSITSNSLYEYLFCLVSAVVVASLLSP 152


>SB_21034| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1101

 Score = 28.7 bits (61), Expect = 4.8
 Identities = 13/30 (43%), Positives = 19/30 (63%)
 Frame = -1

Query: 146  VLGHKLDLRVSLLEHVPQRKRVLAEFELPD 57
            VLGH  ++R   LEH+P  +  L + E+PD
Sbjct: 951  VLGHDENIRTKSLEHLPADQE-LGQLEVPD 979


>SB_42042| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 863

 Score = 27.9 bits (59), Expect = 8.4
 Identities = 16/63 (25%), Positives = 27/63 (42%)
 Frame = -2

Query: 277 LLCHAVWSEGGSLAPDSLYVYLYFLSTCLLTASLQFPYFKLLAMSLATNLTCGFPCSSTY 98
           LLCH++    GS+      V+LYF +T +  +S + P              C  P + T 
Sbjct: 249 LLCHSIV---GSIIRKLFVVFLYFRNTAIFRSSCKLPVTNFWLKLSTIKEPCHRPVTPTV 305

Query: 97  LSV 89
           + +
Sbjct: 306 IPI 308


>SB_10656| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1931

 Score = 27.9 bits (59), Expect = 8.4
 Identities = 12/26 (46%), Positives = 17/26 (65%)
 Frame = +2

Query: 365 AIELQEWLLEEVIPQVLCTGKYDPAI 442
           AI + +W L+ VIP+ LCT K +  I
Sbjct: 420 AIPVDQWNLDYVIPKPLCTTKNNKCI 445


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 21,420,461
Number of Sequences: 59808
Number of extensions: 433315
Number of successful extensions: 1099
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 1012
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1099
length of database: 16,821,457
effective HSP length: 80
effective length of database: 12,036,817
effective search space used: 1841633001
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -