SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A16
         (653 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-sign...    25   2.1  
EF117201-1|ABL67438.1|  481|Anopheles gambiae serpin 17 protein.       23   8.4  

>AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative
           FGF-signaling promoter protein.
          Length = 1197

 Score = 25.0 bits (52), Expect = 2.1
 Identities = 18/59 (30%), Positives = 29/59 (49%), Gaps = 6/59 (10%)
 Frame = +2

Query: 278 QKIQVGQAPILHLIHTDSHLITQEKGGKLKV------FELTNSGYEEDAVIEVDYPGFC 436
           +K++VGQ+ IL ++H     +T+E   K+KV       E+TN        I+   P  C
Sbjct: 398 RKVKVGQSKILLILHEP---LTKEDWIKIKVEKADQTIEITNIKRRNPYTIQFSVPEVC 453


>EF117201-1|ABL67438.1|  481|Anopheles gambiae serpin 17 protein.
          Length = 481

 Score = 23.0 bits (47), Expect = 8.4
 Identities = 12/38 (31%), Positives = 16/38 (42%)
 Frame = -3

Query: 618 VXQGLSHGNSMNFRHITSPSFTDASSYSKEPSFSPLKL 505
           +   L+     N  H+T P F   SS S  P+   L L
Sbjct: 354 IITSLNQNRGTNKMHLTVPKFNVFSSLSLVPALKHLGL 391


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 610,680
Number of Sequences: 2352
Number of extensions: 11685
Number of successful extensions: 24
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 24
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 24
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 64814025
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -