SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbpv0003
         (854 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein.            31   0.034
Z69978-1|CAA93818.1|  268|Anopheles gambiae serine protease prot...    23   9.0  

>AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein.
          Length = 3398

 Score = 31.5 bits (68), Expect = 0.034
 Identities = 18/70 (25%), Positives = 31/70 (44%)
 Frame = +1

Query: 55   NLVKSDYGLSKENFNYFLNALKNDLDTLAERIKEKSEKAGQEISTISQKTAPYFKKIDED 234
            ++ K  Y +    +   L ++K  L+      K+KS K         +K A Y K++DE 
Sbjct: 969  DVFKLHYKVQNNKYVLKLKSMKGPLNNSLTEQKQKSYKQIDASGEAVEKKAQYKKEVDEK 1028

Query: 235  FRREWSNFTR 264
            F  E  N ++
Sbjct: 1029 FAEEVDNISQ 1038


>Z69978-1|CAA93818.1|  268|Anopheles gambiae serine protease
           protein.
          Length = 268

 Score = 23.4 bits (48), Expect = 9.0
 Identities = 6/13 (46%), Positives = 10/13 (76%)
 Frame = -1

Query: 767 WNFSGNYPEPFHF 729
           WN++ +  +PFHF
Sbjct: 46  WNYNNDEQDPFHF 58


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 775,533
Number of Sequences: 2352
Number of extensions: 14454
Number of successful extensions: 21
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 20
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 21
length of database: 563,979
effective HSP length: 64
effective length of database: 413,451
effective search space used: 90959220
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -