SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30160.Seq
         (904 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CR456913-1|CAG33194.1|  640|Homo sapiens PCK2 protein.                137   6e-32
BC001454-1|AAH01454.1|  640|Homo sapiens phosphoenolpyruvate car...   137   6e-32
AY794987-1|AAV50001.1|  622|Homo sapiens phosphoenolpyruvate car...   136   8e-32
BC023978-1|AAH23978.1|  622|Homo sapiens phosphoenolpyruvate car...   136   1e-31
L05144-1|AAA60084.1|  622|Homo sapiens phosphoenolpyruvate carbo...   136   1e-31
AL035541-3|CAB55863.1|  622|Homo sapiens phosphoenolpyruvate car...   135   2e-31
L12760-1|AAA02558.1|  622|Homo sapiens phosphoenolpyruvate carbo...   133   1e-30
Y11484-1|CAA72272.1|  640|Homo sapiens phosphoenolpyruvate carbo...   130   9e-30
X92720-1|CAA63380.1|  640|Homo sapiens phosphoenolpyruvate carbo...   130   9e-30
M64283-1|AAA52699.1|  453|Homo sapiens heparan sulfate proteogly...    31   4.3  
BC117134-1|AAI17135.1| 1709|Homo sapiens chromodomain helicase D...    31   4.3  
AF006513-1|AAB87381.1| 1709|Homo sapiens CHD1 protein.                 31   4.3  

>CR456913-1|CAG33194.1|  640|Homo sapiens PCK2 protein.
          Length = 640

 Score =  137 bits (331), Expect = 6e-32
 Identities = 69/120 (57%), Positives = 81/120 (67%), Gaps = 6/120 (5%)
 Frame = +3

Query: 276 DEQFVRCLHAVGSG----GTP--GWPCDPKNTIILHKPAENEIVXXXXXXXXXXXXXKKC 437
           D  FV+CLH+VG      G P   WPC+P+ T+I H P + EI+             KKC
Sbjct: 204 DGDFVKCLHSVGQPLTGQGEPVSQWPCNPEKTLIGHVPDQREIISFGSGYGGNSLLGKKC 263

Query: 438 FALRLGSVIARREGWLAEHMLIVGITNPQGKKRYIAAAFPSACGKTNLAMMTPNTGPGTK 617
           FALR+ S +AR EGWLAEHMLI+GIT+P GKKRY+AAAFPSACGKTNLAMM P   PG K
Sbjct: 264 FALRIASRLARDEGWLAEHMLILGITSPAGKKRYVAAAFPSACGKTNLAMMRPAL-PGWK 322



 Score = 78.6 bits (185), Expect = 3e-14
 Identities = 34/42 (80%), Positives = 40/42 (95%)
 Frame = +1

Query: 124 GRTMYVIPFSMGPVGSPLSKIGVEITDSPYVVYSMRVMTRIG 249
           GRTMYV+PFSMGPVGSPLS+IGV++TDS YVV SMR+MTR+G
Sbjct: 154 GRTMYVLPFSMGPVGSPLSRIGVQLTDSAYVVASMRIMTRLG 195



 Score = 36.7 bits (81), Expect = 0.12
 Identities = 19/36 (52%), Positives = 23/36 (63%)
 Frame = +2

Query: 605 PGYKVXCVGDDIALMKFRXRTAYFRGHLXRKNGFFG 712
           PG+KV CVGDDIA M+F       R  +  +NGFFG
Sbjct: 319 PGWKVECVGDDIAWMRF-DSEGRLRA-INPENGFFG 352


>BC001454-1|AAH01454.1|  640|Homo sapiens phosphoenolpyruvate
           carboxykinase 2 (mitochondrial) protein.
          Length = 640

 Score =  137 bits (331), Expect = 6e-32
 Identities = 69/120 (57%), Positives = 81/120 (67%), Gaps = 6/120 (5%)
 Frame = +3

Query: 276 DEQFVRCLHAVGSG----GTP--GWPCDPKNTIILHKPAENEIVXXXXXXXXXXXXXKKC 437
           D  FV+CLH+VG      G P   WPC+P+ T+I H P + EI+             KKC
Sbjct: 204 DGDFVKCLHSVGQPLTGQGEPVSQWPCNPEKTLIGHVPDQREIISFGSGYGGNSLLGKKC 263

Query: 438 FALRLGSVIARREGWLAEHMLIVGITNPQGKKRYIAAAFPSACGKTNLAMMTPNTGPGTK 617
           FALR+ S +AR EGWLAEHMLI+GIT+P GKKRY+AAAFPSACGKTNLAMM P   PG K
Sbjct: 264 FALRIASRLARDEGWLAEHMLILGITSPAGKKRYVAAAFPSACGKTNLAMMRPAL-PGWK 322



 Score = 78.6 bits (185), Expect = 3e-14
 Identities = 34/42 (80%), Positives = 40/42 (95%)
 Frame = +1

Query: 124 GRTMYVIPFSMGPVGSPLSKIGVEITDSPYVVYSMRVMTRIG 249
           GRTMYV+PFSMGPVGSPLS+IGV++TDS YVV SMR+MTR+G
Sbjct: 154 GRTMYVLPFSMGPVGSPLSRIGVQLTDSAYVVASMRIMTRLG 195



 Score = 36.7 bits (81), Expect = 0.12
 Identities = 19/36 (52%), Positives = 23/36 (63%)
 Frame = +2

Query: 605 PGYKVXCVGDDIALMKFRXRTAYFRGHLXRKNGFFG 712
           PG+KV CVGDDIA M+F       R  +  +NGFFG
Sbjct: 319 PGWKVECVGDDIAWMRF-DSEGRLRA-INPENGFFG 352


>AY794987-1|AAV50001.1|  622|Homo sapiens phosphoenolpyruvate
           carboxykinase 1 (soluble) protein.
          Length = 622

 Score =  136 bits (330), Expect = 8e-32
 Identities = 70/127 (55%), Positives = 86/127 (67%), Gaps = 6/127 (4%)
 Frame = +3

Query: 255 VLEILRQDEQFVRCLHAVGSG---GTP---GWPCDPKNTIILHKPAENEIVXXXXXXXXX 416
           VLE L  D +FV+CLH+VG       P    WPC+P+ T+I H P   EI+         
Sbjct: 180 VLEALG-DGEFVKCLHSVGCPLPLQKPLVNNWPCNPELTLIAHLPDRREIISFGSGYGGN 238

Query: 417 XXXXKKCFALRLGSVIARREGWLAEHMLIVGITNPQGKKRYIAAAFPSACGKTNLAMMTP 596
               KKCFALR+ S +A+ EGWLAEHMLI+GITNP+G+K+Y+AAAFPSACGKTNLAMM P
Sbjct: 239 SLLGKKCFALRMASRLAKEEGWLAEHMLILGITNPEGEKKYLAAAFPSACGKTNLAMMNP 298

Query: 597 NTGPGTK 617
           +  PG K
Sbjct: 299 SL-PGWK 304



 Score = 83.0 bits (196), Expect = 1e-15
 Identities = 36/42 (85%), Positives = 41/42 (97%)
 Frame = +1

Query: 124 GRTMYVIPFSMGPVGSPLSKIGVEITDSPYVVYSMRVMTRIG 249
           GRTMYVIPFSMGP+GSPLSKIG+E+TDSPYVV SMR+MTR+G
Sbjct: 136 GRTMYVIPFSMGPLGSPLSKIGIELTDSPYVVASMRIMTRMG 177



 Score = 39.9 bits (89), Expect = 0.012
 Identities = 20/36 (55%), Positives = 25/36 (69%)
 Frame = +2

Query: 605 PGYKVXCVGDDIALMKFRXRTAYFRGHLXRKNGFFG 712
           PG+KV CVGDDIA MKF  +  + R  +  +NGFFG
Sbjct: 301 PGWKVECVGDDIAWMKFDAQ-GHLRA-INPENGFFG 334


>BC023978-1|AAH23978.1|  622|Homo sapiens phosphoenolpyruvate
           carboxykinase 1 (soluble) protein.
          Length = 622

 Score =  136 bits (329), Expect = 1e-31
 Identities = 69/127 (54%), Positives = 86/127 (67%), Gaps = 6/127 (4%)
 Frame = +3

Query: 255 VLEILRQDEQFVRCLHAVGSG---GTP---GWPCDPKNTIILHKPAENEIVXXXXXXXXX 416
           VLE L  D +FV+CLH+VG       P    WPC+P+ T+I H P   EI+         
Sbjct: 180 VLEALG-DGEFVKCLHSVGCPLPLQKPLVNNWPCNPELTLIAHLPDRREIISFGSGYGGN 238

Query: 417 XXXXKKCFALRLGSVIARREGWLAEHMLIVGITNPQGKKRYIAAAFPSACGKTNLAMMTP 596
               KKCFALR+ S +A+ EGWLAEHML++GITNP+G+K+Y+AAAFPSACGKTNLAMM P
Sbjct: 239 SLLGKKCFALRMASRLAKEEGWLAEHMLVLGITNPEGEKKYLAAAFPSACGKTNLAMMNP 298

Query: 597 NTGPGTK 617
           +  PG K
Sbjct: 299 SL-PGWK 304



 Score = 83.0 bits (196), Expect = 1e-15
 Identities = 36/42 (85%), Positives = 41/42 (97%)
 Frame = +1

Query: 124 GRTMYVIPFSMGPVGSPLSKIGVEITDSPYVVYSMRVMTRIG 249
           GRTMYVIPFSMGP+GSPLSKIG+E+TDSPYVV SMR+MTR+G
Sbjct: 136 GRTMYVIPFSMGPLGSPLSKIGIELTDSPYVVASMRIMTRMG 177



 Score = 39.9 bits (89), Expect = 0.012
 Identities = 20/36 (55%), Positives = 25/36 (69%)
 Frame = +2

Query: 605 PGYKVXCVGDDIALMKFRXRTAYFRGHLXRKNGFFG 712
           PG+KV CVGDDIA MKF  +  + R  +  +NGFFG
Sbjct: 301 PGWKVECVGDDIAWMKFDAQ-GHLRA-INPENGFFG 334


>L05144-1|AAA60084.1|  622|Homo sapiens phosphoenolpyruvate
           carboxykinase protein.
          Length = 622

 Score =  136 bits (328), Expect = 1e-31
 Identities = 70/127 (55%), Positives = 85/127 (66%), Gaps = 6/127 (4%)
 Frame = +3

Query: 255 VLEILRQDEQFVRCLHAVGSG---GTP---GWPCDPKNTIILHKPAENEIVXXXXXXXXX 416
           VLE L  D +FV+CLH+VG       P    WPC+P+ T+I H P   EI+         
Sbjct: 180 VLEALG-DGEFVKCLHSVGCPLPLQKPLVNNWPCNPELTLIAHLPDRREIISFGSGYGGN 238

Query: 417 XXXXKKCFALRLGSVIARREGWLAEHMLIVGITNPQGKKRYIAAAFPSACGKTNLAMMTP 596
               KKCFALR+ S +A  EGWLAEHMLI+GITNP+G+K+Y+AAAFPSACGKTNLAMM P
Sbjct: 239 SLLGKKCFALRMASRLAEEEGWLAEHMLILGITNPEGEKKYLAAAFPSACGKTNLAMMNP 298

Query: 597 NTGPGTK 617
           +  PG K
Sbjct: 299 SL-PGWK 304



 Score = 83.0 bits (196), Expect = 1e-15
 Identities = 36/42 (85%), Positives = 41/42 (97%)
 Frame = +1

Query: 124 GRTMYVIPFSMGPVGSPLSKIGVEITDSPYVVYSMRVMTRIG 249
           GRTMYVIPFSMGP+GSPLSKIG+E+TDSPYVV SMR+MTR+G
Sbjct: 136 GRTMYVIPFSMGPLGSPLSKIGIELTDSPYVVASMRIMTRMG 177



 Score = 39.9 bits (89), Expect = 0.012
 Identities = 20/36 (55%), Positives = 25/36 (69%)
 Frame = +2

Query: 605 PGYKVXCVGDDIALMKFRXRTAYFRGHLXRKNGFFG 712
           PG+KV CVGDDIA MKF  +  + R  +  +NGFFG
Sbjct: 301 PGWKVECVGDDIAWMKFDAQ-GHLRA-INPENGFFG 334


>AL035541-3|CAB55863.1|  622|Homo sapiens phosphoenolpyruvate
           carboxykinase 1 (soluble) protein.
          Length = 622

 Score =  135 bits (327), Expect = 2e-31
 Identities = 66/120 (55%), Positives = 82/120 (68%), Gaps = 6/120 (5%)
 Frame = +3

Query: 276 DEQFVRCLHAVGSG---GTP---GWPCDPKNTIILHKPAENEIVXXXXXXXXXXXXXKKC 437
           D +FV+CLH+VG       P    WPC+P+ T+I H P   EI+             KKC
Sbjct: 186 DGEFVKCLHSVGCPLPLQKPLVNNWPCNPELTLIAHLPDRREIISFGSGYGGNSLLGKKC 245

Query: 438 FALRLGSVIARREGWLAEHMLIVGITNPQGKKRYIAAAFPSACGKTNLAMMTPNTGPGTK 617
           FALR+ S +A+ EGWLAEHMLI+GITNP+G+K+Y+AAAFPSACGKTNLAMM P+  PG K
Sbjct: 246 FALRMASRLAKEEGWLAEHMLILGITNPEGEKKYLAAAFPSACGKTNLAMMNPSL-PGWK 304



 Score = 83.0 bits (196), Expect = 1e-15
 Identities = 36/42 (85%), Positives = 41/42 (97%)
 Frame = +1

Query: 124 GRTMYVIPFSMGPVGSPLSKIGVEITDSPYVVYSMRVMTRIG 249
           GRTMYVIPFSMGP+GSPLSKIG+E+TDSPYVV SMR+MTR+G
Sbjct: 136 GRTMYVIPFSMGPLGSPLSKIGIELTDSPYVVASMRIMTRMG 177



 Score = 39.9 bits (89), Expect = 0.012
 Identities = 20/36 (55%), Positives = 25/36 (69%)
 Frame = +2

Query: 605 PGYKVXCVGDDIALMKFRXRTAYFRGHLXRKNGFFG 712
           PG+KV CVGDDIA MKF  +  + R  +  +NGFFG
Sbjct: 301 PGWKVECVGDDIAWMKFDAQ-GHLRA-INPENGFFG 334


>L12760-1|AAA02558.1|  622|Homo sapiens phosphoenolpyruvate
           carboxykinase protein.
          Length = 622

 Score =  133 bits (321), Expect = 1e-30
 Identities = 69/127 (54%), Positives = 85/127 (66%), Gaps = 6/127 (4%)
 Frame = +3

Query: 255 VLEILRQDEQFVRCLHAVGSG---GTP---GWPCDPKNTIILHKPAENEIVXXXXXXXXX 416
           VLE L  D +FV+CLH+VG       P    WPC+P+ T+I H P   EI+         
Sbjct: 180 VLEALG-DGEFVKCLHSVGCPLPLQKPLVNNWPCNPELTLIAHLPDRREIISFGSGYGGN 238

Query: 417 XXXXKKCFALRLGSVIARREGWLAEHMLIVGITNPQGKKRYIAAAFPSACGKTNLAMMTP 596
               KKCFALR  S +A+ EGWLAEHMLI+GITNP+G+K+Y+AAAFPSACGK+NLAMM P
Sbjct: 239 SLLGKKCFALRNASRLAKEEGWLAEHMLILGITNPEGEKKYLAAAFPSACGKSNLAMMNP 298

Query: 597 NTGPGTK 617
           +  PG K
Sbjct: 299 SL-PGWK 304



 Score = 83.0 bits (196), Expect = 1e-15
 Identities = 36/42 (85%), Positives = 41/42 (97%)
 Frame = +1

Query: 124 GRTMYVIPFSMGPVGSPLSKIGVEITDSPYVVYSMRVMTRIG 249
           GRTMYVIPFSMGP+GSPLSKIG+E+TDSPYVV SMR+MTR+G
Sbjct: 136 GRTMYVIPFSMGPLGSPLSKIGIELTDSPYVVASMRIMTRMG 177



 Score = 39.9 bits (89), Expect = 0.012
 Identities = 20/36 (55%), Positives = 25/36 (69%)
 Frame = +2

Query: 605 PGYKVXCVGDDIALMKFRXRTAYFRGHLXRKNGFFG 712
           PG+KV CVGDDIA MKF  +  + R  +  +NGFFG
Sbjct: 301 PGWKVECVGDDIAWMKFDAQ-GHLRA-INPENGFFG 334


>Y11484-1|CAA72272.1|  640|Homo sapiens phosphoenolpyruvate
           carboxykinase (GTP) protein.
          Length = 640

 Score =  130 bits (313), Expect = 9e-30
 Identities = 67/120 (55%), Positives = 78/120 (65%), Gaps = 6/120 (5%)
 Frame = +3

Query: 276 DEQFVRCLHAVGSG----GTP--GWPCDPKNTIILHKPAENEIVXXXXXXXXXXXXXKKC 437
           D  FV+CLH+VG      G P   WPC+P+ T+I H P + EI+             KKC
Sbjct: 204 DGDFVKCLHSVGQPLTGQGEPVSQWPCNPEKTLIGHVPDQREIISFGSGYGGNSLLGKKC 263

Query: 438 FALRLGSVIARREGWLAEHMLIVGITNPQGKKRYIAAAFPSACGKTNLAMMTPNTGPGTK 617
           FALR+ S +AR EGWLAEHMLI+GIT+P GKK   AAAFPSACGKTNLAMM P   PG K
Sbjct: 264 FALRIASRLARDEGWLAEHMLILGITSPAGKKALCAAAFPSACGKTNLAMMRPAL-PGWK 322



 Score = 78.6 bits (185), Expect = 3e-14
 Identities = 34/42 (80%), Positives = 40/42 (95%)
 Frame = +1

Query: 124 GRTMYVIPFSMGPVGSPLSKIGVEITDSPYVVYSMRVMTRIG 249
           GRTMYV+PFSMGPVGSPLS+IGV++TDS YVV SMR+MTR+G
Sbjct: 154 GRTMYVLPFSMGPVGSPLSRIGVQLTDSAYVVASMRIMTRLG 195



 Score = 36.7 bits (81), Expect = 0.12
 Identities = 19/36 (52%), Positives = 23/36 (63%)
 Frame = +2

Query: 605 PGYKVXCVGDDIALMKFRXRTAYFRGHLXRKNGFFG 712
           PG+KV CVGDDIA M+F       R  +  +NGFFG
Sbjct: 319 PGWKVECVGDDIAWMRF-DSEGRLRA-INPENGFFG 352


>X92720-1|CAA63380.1|  640|Homo sapiens phosphoenolpyruvate
           carboxykinase (GTP) protein.
          Length = 640

 Score =  130 bits (313), Expect = 9e-30
 Identities = 67/120 (55%), Positives = 78/120 (65%), Gaps = 6/120 (5%)
 Frame = +3

Query: 276 DEQFVRCLHAVGSG----GTP--GWPCDPKNTIILHKPAENEIVXXXXXXXXXXXXXKKC 437
           D  FV+CLH+VG      G P   WPC+P+ T+I H P + EI+             KKC
Sbjct: 204 DGDFVKCLHSVGQPLTGQGEPVSQWPCNPEKTLIGHVPDQREIISFGSGYGGNSLLGKKC 263

Query: 438 FALRLGSVIARREGWLAEHMLIVGITNPQGKKRYIAAAFPSACGKTNLAMMTPNTGPGTK 617
           FALR+ S +AR EGWLAEHMLI+GIT+P GKK   AAAFPSACGKTNLAMM P   PG K
Sbjct: 264 FALRIASRLARDEGWLAEHMLILGITSPAGKKALCAAAFPSACGKTNLAMMRPAL-PGWK 322



 Score = 78.6 bits (185), Expect = 3e-14
 Identities = 34/42 (80%), Positives = 40/42 (95%)
 Frame = +1

Query: 124 GRTMYVIPFSMGPVGSPLSKIGVEITDSPYVVYSMRVMTRIG 249
           GRTMYV+PFSMGPVGSPLS+IGV++TDS YVV SMR+MTR+G
Sbjct: 154 GRTMYVLPFSMGPVGSPLSRIGVQLTDSAYVVASMRIMTRLG 195



 Score = 36.7 bits (81), Expect = 0.12
 Identities = 19/36 (52%), Positives = 23/36 (63%)
 Frame = +2

Query: 605 PGYKVXCVGDDIALMKFRXRTAYFRGHLXRKNGFFG 712
           PG+KV CVGDDIA M+F       R  +  +NGFFG
Sbjct: 319 PGWKVECVGDDIAWMRF-DSEGRLRA-INPENGFFG 352


>M64283-1|AAA52699.1|  453|Homo sapiens heparan sulfate proteoglycan
           protein.
          Length = 453

 Score = 31.5 bits (68), Expect = 4.3
 Identities = 16/36 (44%), Positives = 22/36 (61%)
 Frame = +1

Query: 94  GMKLNGMG*DGRTMYVIPFSMGPVGSPLSKIGVEIT 201
           G K+ G G  G+  Y + ++ GP GSPLS   V+IT
Sbjct: 388 GGKVAGYG--GKLRYTLSYTAGPQGSPLSDPDVQIT 421


>BC117134-1|AAI17135.1| 1709|Homo sapiens chromodomain helicase DNA
            binding protein 1 protein.
          Length = 1709

 Score = 31.5 bits (68), Expect = 4.3
 Identities = 23/70 (32%), Positives = 34/70 (48%), Gaps = 4/70 (5%)
 Frame = -2

Query: 324  ECHRSRLREDNERTARLDVE-FLELRSNS---SHDSHRINHVRRIRDFYADLRERRSHRT 157
            E HR +L +   R  R ++E  L+ RS+S   SH  HR++   R    Y   +  R +R 
Sbjct: 1602 EKHR-KLDDHRSRDHRSNLEGSLKDRSHSDHRSHSDHRLHSDHRSSSEYTHHKSSRDYRY 1660

Query: 156  HREWYHVHCA 127
            H +W   H A
Sbjct: 1661 HSDWQMDHRA 1670


>AF006513-1|AAB87381.1| 1709|Homo sapiens CHD1 protein.
          Length = 1709

 Score = 31.5 bits (68), Expect = 4.3
 Identities = 23/70 (32%), Positives = 34/70 (48%), Gaps = 4/70 (5%)
 Frame = -2

Query: 324  ECHRSRLREDNERTARLDVE-FLELRSNS---SHDSHRINHVRRIRDFYADLRERRSHRT 157
            E HR +L +   R  R ++E  L+ RS+S   SH  HR++   R    Y   +  R +R 
Sbjct: 1602 EKHR-KLDDHRSRDHRSNLEGSLKDRSHSDHRSHSDHRLHSDHRSSSEYTHHKSSRDYRY 1660

Query: 156  HREWYHVHCA 127
            H +W   H A
Sbjct: 1661 HSDWQMDHRA 1670


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 126,365,246
Number of Sequences: 237096
Number of extensions: 2646729
Number of successful extensions: 6180
Number of sequences better than 10.0: 12
Number of HSP's better than 10.0 without gapping: 5540
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6150
length of database: 76,859,062
effective HSP length: 90
effective length of database: 55,520,422
effective search space used: 11659288620
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -