SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20067
         (619 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U15220-1|AAA61796.1| 1051|Drosophila melanogaster gp150 protein ...    84   1e-16
BT015195-1|AAT94424.1| 1076|Drosophila melanogaster RE72245p pro...    84   1e-16
BT011025-1|AAR30185.1| 1051|Drosophila melanogaster RE46351p pro...    84   1e-16
AY029705-1|AAK39644.1| 1051|Drosophila melanogaster leucine rich...    84   1e-16
AE013599-3379|AAG22195.1| 1051|Drosophila melanogaster CG5820-PC...    84   1e-16
AE013599-3378|AAM68222.1| 1051|Drosophila melanogaster CG5820-PB...    84   1e-16
AE013599-3377|AAF46831.1| 1051|Drosophila melanogaster CG5820-PA...    84   1e-16
AE013599-3376|AAM68221.1| 1076|Drosophila melanogaster CG5820-PD...    84   1e-16
AE014296-2672|AAF49513.1|  597|Drosophila melanogaster CG4950-PA...    35   0.077
BT023770-1|AAZ41778.1|  931|Drosophila melanogaster LP23752p pro...    33   0.23 
AY195738-1|AAO43730.1|  917|Drosophila melanogaster kekkon5 prec...    33   0.23 
AE014298-2840|AAN09488.1|  931|Drosophila melanogaster CG12199-P...    33   0.23 
AE014298-2839|AAF48953.2|  931|Drosophila melanogaster CG12199-P...    33   0.23 
BT029642-1|ABL75701.1|  492|Drosophila melanogaster IP17187p pro...    30   2.9  
BT029615-1|ABL75674.1|  493|Drosophila melanogaster IP17087p pro...    30   2.9  
BT029571-1|ABL75630.1|  492|Drosophila melanogaster IP16887p pro...    30   2.9  
AE013599-1865|AAF58265.1|  953|Drosophila melanogaster CG8561-PA...    30   2.9  
AY061000-1|AAL28548.1|  328|Drosophila melanogaster HL01517p pro...    28   8.8  
AF132159-1|AAD34747.1|  823|Drosophila melanogaster unknown prot...    28   8.8  
AE014298-1970|AAF48327.1|  823|Drosophila melanogaster CG11092-P...    28   8.8  
AE013599-3624|AAF47023.1|  328|Drosophila melanogaster CG3957-PA...    28   8.8  

>U15220-1|AAA61796.1| 1051|Drosophila melanogaster gp150 protein
           protein.
          Length = 1051

 Score = 84.2 bits (199), Expect = 1e-16
 Identities = 40/80 (50%), Positives = 52/80 (65%), Gaps = 1/80 (1%)
 Frame = +1

Query: 256 NEDRPCPRDCICSVS-QGYRQAKCSFLEIGTQKFGDDILDLVVENADPRYPINLDDFMFK 432
           +ED PCPR C C+ +   Y  A CS L++G QKFG DI DLVV N  P+YPI +    F+
Sbjct: 228 SEDVPCPRFCQCARNVNSYLVATCSRLDMGIQKFGSDITDLVVTNVGPKYPILMGPNFFQ 287

Query: 433 KLGLHQVATVKIVNSTIGYI 492
            LGL  VA++KI N T+ Y+
Sbjct: 288 NLGLKNVASIKIANCTLEYL 307



 Score = 31.5 bits (68), Expect = 0.94
 Identities = 12/27 (44%), Positives = 21/27 (77%)
 Frame = +2

Query: 497 QCFPGVHDLYAVNLSNNNLKSLHPETF 577
           + F G+++LYAVNL++  L  ++P+TF
Sbjct: 310 EAFHGLNELYAVNLTDVGLAIINPDTF 336


>BT015195-1|AAT94424.1| 1076|Drosophila melanogaster RE72245p
           protein.
          Length = 1076

 Score = 84.2 bits (199), Expect = 1e-16
 Identities = 40/80 (50%), Positives = 52/80 (65%), Gaps = 1/80 (1%)
 Frame = +1

Query: 256 NEDRPCPRDCICSVS-QGYRQAKCSFLEIGTQKFGDDILDLVVENADPRYPINLDDFMFK 432
           +ED PCPR C C+ +   Y  A CS L++G QKFG DI DLVV N  P+YPI +    F+
Sbjct: 253 SEDVPCPRFCQCARNVNSYLVATCSRLDMGIQKFGSDITDLVVTNVGPKYPILMGPNFFQ 312

Query: 433 KLGLHQVATVKIVNSTIGYI 492
            LGL  VA++KI N T+ Y+
Sbjct: 313 NLGLKNVASIKIANCTLEYL 332



 Score = 31.5 bits (68), Expect = 0.94
 Identities = 12/27 (44%), Positives = 21/27 (77%)
 Frame = +2

Query: 497 QCFPGVHDLYAVNLSNNNLKSLHPETF 577
           + F G+++LYAVNL++  L  ++P+TF
Sbjct: 335 EAFHGLNELYAVNLTDVGLAIINPDTF 361


>BT011025-1|AAR30185.1| 1051|Drosophila melanogaster RE46351p
           protein.
          Length = 1051

 Score = 84.2 bits (199), Expect = 1e-16
 Identities = 40/80 (50%), Positives = 52/80 (65%), Gaps = 1/80 (1%)
 Frame = +1

Query: 256 NEDRPCPRDCICSVS-QGYRQAKCSFLEIGTQKFGDDILDLVVENADPRYPINLDDFMFK 432
           +ED PCPR C C+ +   Y  A CS L++G QKFG DI DLVV N  P+YPI +    F+
Sbjct: 228 SEDVPCPRFCQCARNVNSYLVATCSRLDMGIQKFGSDITDLVVTNVGPKYPILMGPNFFQ 287

Query: 433 KLGLHQVATVKIVNSTIGYI 492
            LGL  VA++KI N T+ Y+
Sbjct: 288 NLGLKNVASIKIANCTLEYL 307



 Score = 31.5 bits (68), Expect = 0.94
 Identities = 12/27 (44%), Positives = 21/27 (77%)
 Frame = +2

Query: 497 QCFPGVHDLYAVNLSNNNLKSLHPETF 577
           + F G+++LYAVNL++  L  ++P+TF
Sbjct: 310 EAFHGLNELYAVNLTDVGLAIINPDTF 336


>AY029705-1|AAK39644.1| 1051|Drosophila melanogaster leucine rich
           repeat protein GP150 protein.
          Length = 1051

 Score = 84.2 bits (199), Expect = 1e-16
 Identities = 40/80 (50%), Positives = 52/80 (65%), Gaps = 1/80 (1%)
 Frame = +1

Query: 256 NEDRPCPRDCICSVS-QGYRQAKCSFLEIGTQKFGDDILDLVVENADPRYPINLDDFMFK 432
           +ED PCPR C C+ +   Y  A CS L++G QKFG DI DLVV N  P+YPI +    F+
Sbjct: 228 SEDVPCPRFCQCARNVNSYLVATCSRLDMGIQKFGSDITDLVVTNVGPKYPILMGPNFFQ 287

Query: 433 KLGLHQVATVKIVNSTIGYI 492
            LGL  VA++KI N T+ Y+
Sbjct: 288 NLGLKNVASIKIANCTLEYL 307



 Score = 31.5 bits (68), Expect = 0.94
 Identities = 12/27 (44%), Positives = 21/27 (77%)
 Frame = +2

Query: 497 QCFPGVHDLYAVNLSNNNLKSLHPETF 577
           + F G+++LYAVNL++  L  ++P+TF
Sbjct: 310 EAFHGLNELYAVNLTDVGLAIINPDTF 336


>AE013599-3379|AAG22195.1| 1051|Drosophila melanogaster CG5820-PC,
           isoform C protein.
          Length = 1051

 Score = 84.2 bits (199), Expect = 1e-16
 Identities = 40/80 (50%), Positives = 52/80 (65%), Gaps = 1/80 (1%)
 Frame = +1

Query: 256 NEDRPCPRDCICSVS-QGYRQAKCSFLEIGTQKFGDDILDLVVENADPRYPINLDDFMFK 432
           +ED PCPR C C+ +   Y  A CS L++G QKFG DI DLVV N  P+YPI +    F+
Sbjct: 228 SEDVPCPRFCQCARNVNSYLVATCSRLDMGIQKFGSDITDLVVTNVGPKYPILMGPNFFQ 287

Query: 433 KLGLHQVATVKIVNSTIGYI 492
            LGL  VA++KI N T+ Y+
Sbjct: 288 NLGLKNVASIKIANCTLEYL 307



 Score = 31.5 bits (68), Expect = 0.94
 Identities = 12/27 (44%), Positives = 21/27 (77%)
 Frame = +2

Query: 497 QCFPGVHDLYAVNLSNNNLKSLHPETF 577
           + F G+++LYAVNL++  L  ++P+TF
Sbjct: 310 EAFHGLNELYAVNLTDVGLAIINPDTF 336


>AE013599-3378|AAM68222.1| 1051|Drosophila melanogaster CG5820-PB,
           isoform B protein.
          Length = 1051

 Score = 84.2 bits (199), Expect = 1e-16
 Identities = 40/80 (50%), Positives = 52/80 (65%), Gaps = 1/80 (1%)
 Frame = +1

Query: 256 NEDRPCPRDCICSVS-QGYRQAKCSFLEIGTQKFGDDILDLVVENADPRYPINLDDFMFK 432
           +ED PCPR C C+ +   Y  A CS L++G QKFG DI DLVV N  P+YPI +    F+
Sbjct: 228 SEDVPCPRFCQCARNVNSYLVATCSRLDMGIQKFGSDITDLVVTNVGPKYPILMGPNFFQ 287

Query: 433 KLGLHQVATVKIVNSTIGYI 492
            LGL  VA++KI N T+ Y+
Sbjct: 288 NLGLKNVASIKIANCTLEYL 307



 Score = 31.5 bits (68), Expect = 0.94
 Identities = 12/27 (44%), Positives = 21/27 (77%)
 Frame = +2

Query: 497 QCFPGVHDLYAVNLSNNNLKSLHPETF 577
           + F G+++LYAVNL++  L  ++P+TF
Sbjct: 310 EAFHGLNELYAVNLTDVGLAIINPDTF 336


>AE013599-3377|AAF46831.1| 1051|Drosophila melanogaster CG5820-PA,
           isoform A protein.
          Length = 1051

 Score = 84.2 bits (199), Expect = 1e-16
 Identities = 40/80 (50%), Positives = 52/80 (65%), Gaps = 1/80 (1%)
 Frame = +1

Query: 256 NEDRPCPRDCICSVS-QGYRQAKCSFLEIGTQKFGDDILDLVVENADPRYPINLDDFMFK 432
           +ED PCPR C C+ +   Y  A CS L++G QKFG DI DLVV N  P+YPI +    F+
Sbjct: 228 SEDVPCPRFCQCARNVNSYLVATCSRLDMGIQKFGSDITDLVVTNVGPKYPILMGPNFFQ 287

Query: 433 KLGLHQVATVKIVNSTIGYI 492
            LGL  VA++KI N T+ Y+
Sbjct: 288 NLGLKNVASIKIANCTLEYL 307



 Score = 31.5 bits (68), Expect = 0.94
 Identities = 12/27 (44%), Positives = 21/27 (77%)
 Frame = +2

Query: 497 QCFPGVHDLYAVNLSNNNLKSLHPETF 577
           + F G+++LYAVNL++  L  ++P+TF
Sbjct: 310 EAFHGLNELYAVNLTDVGLAIINPDTF 336


>AE013599-3376|AAM68221.1| 1076|Drosophila melanogaster CG5820-PD,
           isoform D protein.
          Length = 1076

 Score = 84.2 bits (199), Expect = 1e-16
 Identities = 40/80 (50%), Positives = 52/80 (65%), Gaps = 1/80 (1%)
 Frame = +1

Query: 256 NEDRPCPRDCICSVS-QGYRQAKCSFLEIGTQKFGDDILDLVVENADPRYPINLDDFMFK 432
           +ED PCPR C C+ +   Y  A CS L++G QKFG DI DLVV N  P+YPI +    F+
Sbjct: 253 SEDVPCPRFCQCARNVNSYLVATCSRLDMGIQKFGSDITDLVVTNVGPKYPILMGPNFFQ 312

Query: 433 KLGLHQVATVKIVNSTIGYI 492
            LGL  VA++KI N T+ Y+
Sbjct: 313 NLGLKNVASIKIANCTLEYL 332



 Score = 31.5 bits (68), Expect = 0.94
 Identities = 12/27 (44%), Positives = 21/27 (77%)
 Frame = +2

Query: 497 QCFPGVHDLYAVNLSNNNLKSLHPETF 577
           + F G+++LYAVNL++  L  ++P+TF
Sbjct: 335 EAFHGLNELYAVNLTDVGLAIINPDTF 361


>AE014296-2672|AAF49513.1|  597|Drosophila melanogaster CG4950-PA
           protein.
          Length = 597

 Score = 35.1 bits (77), Expect = 0.077
 Identities = 15/31 (48%), Positives = 20/31 (64%)
 Frame = +2

Query: 488 ISPQCFPGVHDLYAVNLSNNNLKSLHPETFA 580
           I P+ F  +  +  VNLSNN L  +HP+TFA
Sbjct: 228 IQPEVFRNMRRIKEVNLSNNRLIFIHPDTFA 258


>BT023770-1|AAZ41778.1|  931|Drosophila melanogaster LP23752p
           protein.
          Length = 931

 Score = 33.5 bits (73), Expect = 0.23
 Identities = 13/28 (46%), Positives = 19/28 (67%)
 Frame = +2

Query: 497 QCFPGVHDLYAVNLSNNNLKSLHPETFA 580
           + F G+H L  ++LS N ++ LHP TFA
Sbjct: 117 EAFKGLHILIELDLSGNRIRELHPGTFA 144


>AY195738-1|AAO43730.1|  917|Drosophila melanogaster kekkon5
           precursor protein.
          Length = 917

 Score = 33.5 bits (73), Expect = 0.23
 Identities = 13/28 (46%), Positives = 19/28 (67%)
 Frame = +2

Query: 497 QCFPGVHDLYAVNLSNNNLKSLHPETFA 580
           + F G+H L  ++LS N ++ LHP TFA
Sbjct: 103 EAFKGLHILIELDLSGNRIRELHPGTFA 130


>AE014298-2840|AAN09488.1|  931|Drosophila melanogaster CG12199-PB,
           isoform B protein.
          Length = 931

 Score = 33.5 bits (73), Expect = 0.23
 Identities = 13/28 (46%), Positives = 19/28 (67%)
 Frame = +2

Query: 497 QCFPGVHDLYAVNLSNNNLKSLHPETFA 580
           + F G+H L  ++LS N ++ LHP TFA
Sbjct: 117 EAFKGLHILIELDLSGNRIRELHPGTFA 144


>AE014298-2839|AAF48953.2|  931|Drosophila melanogaster CG12199-PA,
           isoform A protein.
          Length = 931

 Score = 33.5 bits (73), Expect = 0.23
 Identities = 13/28 (46%), Positives = 19/28 (67%)
 Frame = +2

Query: 497 QCFPGVHDLYAVNLSNNNLKSLHPETFA 580
           + F G+H L  ++LS N ++ LHP TFA
Sbjct: 117 EAFKGLHILIELDLSGNRIRELHPGTFA 144


>BT029642-1|ABL75701.1|  492|Drosophila melanogaster IP17187p
           protein.
          Length = 492

 Score = 29.9 bits (64), Expect = 2.9
 Identities = 10/30 (33%), Positives = 20/30 (66%)
 Frame = +2

Query: 488 ISPQCFPGVHDLYAVNLSNNNLKSLHPETF 577
           I   CFP +++L+ +++S+NN+ S+    F
Sbjct: 452 IPKNCFPKLYELHTIDVSHNNISSIFNGVF 481


>BT029615-1|ABL75674.1|  493|Drosophila melanogaster IP17087p
           protein.
          Length = 493

 Score = 29.9 bits (64), Expect = 2.9
 Identities = 10/30 (33%), Positives = 20/30 (66%)
 Frame = +2

Query: 488 ISPQCFPGVHDLYAVNLSNNNLKSLHPETF 577
           I   CFP +++L+ +++S+NN+ S+    F
Sbjct: 452 IPKNCFPKLYELHTIDVSHNNISSIFNGVF 481


>BT029571-1|ABL75630.1|  492|Drosophila melanogaster IP16887p
           protein.
          Length = 492

 Score = 29.9 bits (64), Expect = 2.9
 Identities = 10/30 (33%), Positives = 20/30 (66%)
 Frame = +2

Query: 488 ISPQCFPGVHDLYAVNLSNNNLKSLHPETF 577
           I   CFP +++L+ +++S+NN+ S+    F
Sbjct: 452 IPKNCFPKLYELHTIDVSHNNISSIFNGVF 481


>AE013599-1865|AAF58265.1|  953|Drosophila melanogaster CG8561-PA
           protein.
          Length = 953

 Score = 29.9 bits (64), Expect = 2.9
 Identities = 10/30 (33%), Positives = 20/30 (66%)
 Frame = +2

Query: 488 ISPQCFPGVHDLYAVNLSNNNLKSLHPETF 577
           I   CFP +++L+ +++S+NN+ S+    F
Sbjct: 351 IPKNCFPKLYELHTIDVSHNNISSIFNGVF 380


>AY061000-1|AAL28548.1|  328|Drosophila melanogaster HL01517p
           protein.
          Length = 328

 Score = 28.3 bits (60), Expect = 8.8
 Identities = 10/29 (34%), Positives = 16/29 (55%)
 Frame = -2

Query: 507 GKHWGDITNRAVHDFYSSNLVKSEFFEHE 421
           GK W  +T   +H F   ++VKS  F+ +
Sbjct: 86  GKVWNAVTGAEIHSFQHKHIVKSVAFDRD 114


>AF132159-1|AAD34747.1|  823|Drosophila melanogaster unknown
           protein.
          Length = 823

 Score = 28.3 bits (60), Expect = 8.8
 Identities = 14/43 (32%), Positives = 21/43 (48%)
 Frame = +2

Query: 173 TVKKDKDADNLLDQYEDYEPAEYQEVLSTRTGPVPETAYALYL 301
           T++K+ D DNL+ + E     EY   L   T P  +  Y + L
Sbjct: 346 TLRKNGDRDNLMVKLEGQLKLEYNSRLRACTDPYKKAVYVVLL 388


>AE014298-1970|AAF48327.1|  823|Drosophila melanogaster CG11092-PA
           protein.
          Length = 823

 Score = 28.3 bits (60), Expect = 8.8
 Identities = 14/43 (32%), Positives = 21/43 (48%)
 Frame = +2

Query: 173 TVKKDKDADNLLDQYEDYEPAEYQEVLSTRTGPVPETAYALYL 301
           T++K+ D DNL+ + E     EY   L   T P  +  Y + L
Sbjct: 346 TLRKNGDRDNLMVKLEGQLKLEYNSRLRACTDPYKKAVYVVLL 388


>AE013599-3624|AAF47023.1|  328|Drosophila melanogaster CG3957-PA
           protein.
          Length = 328

 Score = 28.3 bits (60), Expect = 8.8
 Identities = 10/29 (34%), Positives = 16/29 (55%)
 Frame = -2

Query: 507 GKHWGDITNRAVHDFYSSNLVKSEFFEHE 421
           GK W  +T   +H F   ++VKS  F+ +
Sbjct: 86  GKVWNAVTGAEIHSFQHKHIVKSVAFDRD 114


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 26,738,000
Number of Sequences: 53049
Number of extensions: 546611
Number of successful extensions: 1692
Number of sequences better than 10.0: 21
Number of HSP's better than 10.0 without gapping: 1557
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1684
length of database: 24,988,368
effective HSP length: 82
effective length of database: 20,638,350
effective search space used: 2538517050
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -