SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30156.Seq
         (961 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U42436-10|AAF99899.1|  272|Caenorhabditis elegans Ribosomal prot...   138   4e-33
Z74041-9|CAA98523.2|  801|Caenorhabditis elegans Hypothetical pr...    29   6.5  
Z74035-5|CAA98485.2|  801|Caenorhabditis elegans Hypothetical pr...    29   6.5  
Z66523-7|CAA91416.2|  409|Caenorhabditis elegans Hypothetical pr...    28   8.6  

>U42436-10|AAF99899.1|  272|Caenorhabditis elegans Ribosomal
           protein, small subunitprotein 2 protein.
          Length = 272

 Score =  138 bits (335), Expect = 4e-33
 Identities = 74/109 (67%), Positives = 82/109 (75%)
 Frame = +1

Query: 217 RKNRQTREHLLVFLPIKEFEIIDFFLGPSLNDEVLKIMPVQKQTRAGQRTRFKAFVAIGD 396
           +K     E  L  LPIKEFEIID  L  +L DEVLKI PVQKQT AGQRTRFKAFVAIGD
Sbjct: 70  KKITTLEEIYLNSLPIKEFEIIDA-LCSNLKDEVLKISPVQKQTTAGQRTRFKAFVAIGD 128

Query: 397 NNGHIGLGVKCSKEVATAIRGAIILAKLSVLTSPKKLRGNKIGKPHNRP 543
           + GH+GLGVKCSKEVATAIRGAI+ AKL+V+   +   GNKIG PH  P
Sbjct: 129 HAGHVGLGVKCSKEVATAIRGAIVAAKLAVVPVRRGYWGNKIGLPHTVP 177



 Score = 44.8 bits (101), Expect = 9e-05
 Identities = 20/29 (68%), Positives = 22/29 (75%)
 Frame = +2

Query: 164 EDQKEWVPVTKLGRLVREGKIDKLESIYL 250
           E + EW PVTKLGRLV+E KI  LE IYL
Sbjct: 52  EKETEWTPVTKLGRLVKEKKITTLEEIYL 80



 Score = 30.7 bits (66), Expect = 1.6
 Identities = 18/37 (48%), Positives = 20/37 (54%)
 Frame = +2

Query: 491 PVRRSYGVTR*ESHTTVPCKVXGQXWFPKQFRLIPAP 601
           PVRR Y   +     TVPCKV G+       RLIPAP
Sbjct: 160 PVRRGYWGNKIGLPHTVPCKVTGKC-ASVMVRLIPAP 195


>Z74041-9|CAA98523.2|  801|Caenorhabditis elegans Hypothetical
           protein F47G9.3 protein.
          Length = 801

 Score = 28.7 bits (61), Expect = 6.5
 Identities = 12/30 (40%), Positives = 18/30 (60%), Gaps = 1/30 (3%)
 Frame = -2

Query: 384 NKCLETCALSGTCLFLYR-HDLKNLIIQGR 298
           ++CLE C +S  C F Y+  D+ N +I  R
Sbjct: 286 SECLEKCTMSEECRFAYQSKDMNNCLISRR 315


>Z74035-5|CAA98485.2|  801|Caenorhabditis elegans Hypothetical
           protein F47G9.3 protein.
          Length = 801

 Score = 28.7 bits (61), Expect = 6.5
 Identities = 12/30 (40%), Positives = 18/30 (60%), Gaps = 1/30 (3%)
 Frame = -2

Query: 384 NKCLETCALSGTCLFLYR-HDLKNLIIQGR 298
           ++CLE C +S  C F Y+  D+ N +I  R
Sbjct: 286 SECLEKCTMSEECRFAYQSKDMNNCLISRR 315


>Z66523-7|CAA91416.2|  409|Caenorhabditis elegans Hypothetical
           protein M05D6.7 protein.
          Length = 409

 Score = 28.3 bits (60), Expect = 8.6
 Identities = 13/30 (43%), Positives = 20/30 (66%)
 Frame = +2

Query: 194 KLGRLVREGKIDKLESIYLFFYQSKNSRSL 283
           K+G ++REGK++K  S     Y+  NS+SL
Sbjct: 107 KIGNIIREGKVEKNVSNDNKIYELWNSKSL 136


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,970,103
Number of Sequences: 27780
Number of extensions: 380095
Number of successful extensions: 868
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 819
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 865
length of database: 12,740,198
effective HSP length: 81
effective length of database: 10,490,018
effective search space used: 2496624284
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -