SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30132.Seq
         (689 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U41624-2|AAF99943.2|  351|Caenorhabditis elegans C.elegans homeo...    33   0.19 
AF244368-1|AAF77181.1|  351|Caenorhabditis elegans LIM homeobox ...    33   0.19 
AY349017-1|AAQ55497.1|  474|Caenorhabditis elegans NHR-91A protein.    33   0.25 
AL132841-4|CAB60329.2|  474|Caenorhabditis elegans Hypothetical ...    33   0.25 
AF273835-1|AAG15183.1|  476|Caenorhabditis elegans nuclear recep...    33   0.25 
AF273834-1|AAG15182.1|  475|Caenorhabditis elegans nuclear recep...    33   0.25 
AF273833-1|AAG15181.1|  475|Caenorhabditis elegans nuclear recep...    33   0.25 
Z47811-3|CAA87787.2|  723|Caenorhabditis elegans Hypothetical pr...    31   0.59 
AF489839-1|AAN09795.1|  723|Caenorhabditis elegans lim and trans...    31   0.59 
Z81054-4|CAB02885.3|  321|Caenorhabditis elegans Hypothetical pr...    30   1.4  
L02877-1|AAA50614.1|  321|Caenorhabditis elegans homeoprotein pr...    30   1.4  
U41021-4|AAA82334.1|  348|Caenorhabditis elegans Uncoordinated p...    30   1.8  
AF035583-1|AAD09435.1|  348|Caenorhabditis elegans UNC-97 protein.     30   1.8  
U53149-4|AAA96120.1|  956|Caenorhabditis elegans Patched related...    29   4.1  
Z71181-9|CAD44140.1|  960|Caenorhabditis elegans Hypothetical pr...    28   5.5  
Z71178-18|CAH04640.1|  671|Caenorhabditis elegans Hypothetical p...    28   5.5  
Z71178-17|CAD44089.1|  898|Caenorhabditis elegans Hypothetical p...    28   5.5  
Z71178-15|CAD44087.1|  960|Caenorhabditis elegans Hypothetical p...    28   5.5  
Z71178-14|CAA94886.3|  894|Caenorhabditis elegans Hypothetical p...    28   5.5  
U55375-4|AAC69042.3|  287|Caenorhabditis elegans Lim domain fami...    28   5.5  
U39471-2|AAA80131.1|   92|Caenorhabditis elegans Hypothetical pr...    28   5.5  
AL021478-4|CAJ26240.1|  671|Caenorhabditis elegans Hypothetical ...    28   5.5  
AL021478-3|CAF32233.1|  898|Caenorhabditis elegans Hypothetical ...    28   5.5  
AL021478-1|CAC35857.2|  894|Caenorhabditis elegans Hypothetical ...    28   5.5  
U67951-2|AAB07570.2|  302|Caenorhabditis elegans Regulator of fu...    28   7.2  
U67951-1|AAQ65207.1|  315|Caenorhabditis elegans Regulator of fu...    28   7.2  
U58751-9|AAB00660.1|  133|Caenorhabditis elegans Hypothetical pr...    28   7.2  
AY115477-1|AAM55473.1|  303|Caenorhabditis elegans zinc finger p...    28   7.2  
Z54237-10|CAJ43909.1|  684|Caenorhabditis elegans Hypothetical p...    27   9.6  
Z54237-9|CAA90991.1| 1424|Caenorhabditis elegans Hypothetical pr...    27   9.6  
Z54237-8|CAE52902.1|  771|Caenorhabditis elegans Hypothetical pr...    27   9.6  
Z54237-7|CAB54312.2|  645|Caenorhabditis elegans Hypothetical pr...    27   9.6  
Z54235-13|CAJ43902.1|  684|Caenorhabditis elegans Hypothetical p...    27   9.6  
Z54235-11|CAA90978.1| 1424|Caenorhabditis elegans Hypothetical p...    27   9.6  
Z54235-10|CAE52905.1|  771|Caenorhabditis elegans Hypothetical p...    27   9.6  
Z54235-9|CAB54190.2|  645|Caenorhabditis elegans Hypothetical pr...    27   9.6  
AF353303-1|AAK32717.1|  367|Caenorhabditis elegans GATA-like tra...    27   9.6  
AF100657-1|AAC68957.3|  367|Caenorhabditis elegans Erythroid-lik...    27   9.6  
AC024776-3|AAK68466.1|  453|Caenorhabditis elegans Hypothetical ...    27   9.6  

>U41624-2|AAF99943.2|  351|Caenorhabditis elegans C.elegans homeobox
           protein 14 protein.
          Length = 351

 Score = 33.1 bits (72), Expect = 0.19
 Identities = 12/45 (26%), Positives = 23/45 (51%)
 Frame = +1

Query: 367 SKSEASEGNTKRSVCSRCLQMINENNKIEIDKQAFHSHCAKCYFC 501
           S   A   N + ++CS C + I +    +++ + +HS C +C  C
Sbjct: 34  SNVNAGHPNNEEAICSLCDKKIRDRFVSKVNGRCYHSSCLRCSTC 78


>AF244368-1|AAF77181.1|  351|Caenorhabditis elegans LIM homeobox
           protein CEH-14 protein.
          Length = 351

 Score = 33.1 bits (72), Expect = 0.19
 Identities = 12/45 (26%), Positives = 23/45 (51%)
 Frame = +1

Query: 367 SKSEASEGNTKRSVCSRCLQMINENNKIEIDKQAFHSHCAKCYFC 501
           S   A   N + ++CS C + I +    +++ + +HS C +C  C
Sbjct: 34  SNVNAGHPNNEEAICSLCDKKIRDRFVSKVNGRCYHSSCLRCSTC 78


>AY349017-1|AAQ55497.1|  474|Caenorhabditis elegans NHR-91A protein.
          Length = 474

 Score = 32.7 bits (71), Expect = 0.25
 Identities = 22/73 (30%), Positives = 37/73 (50%)
 Frame = +1

Query: 319 CGKFGNGQEGDNPGASSKSEASEGNTKRSVCSRCLQMINENNKIEIDKQAFHSHCAKCYF 498
           C   G+   G + GA++  E  +G  KRSV ++ +   +++N  EIDKQ   + C  C F
Sbjct: 100 CSVCGDKSTGLHYGAAT-CEGCKGFFKRSVQNKKVYHCSQDNCCEIDKQN-RNRCQSCRF 157

Query: 499 CHTVHRPTSTSAM 537
              + +   T A+
Sbjct: 158 RKCISKGMLTEAV 170


>AL132841-4|CAB60329.2|  474|Caenorhabditis elegans Hypothetical
           protein Y15E3A.1a protein.
          Length = 474

 Score = 32.7 bits (71), Expect = 0.25
 Identities = 22/73 (30%), Positives = 37/73 (50%)
 Frame = +1

Query: 319 CGKFGNGQEGDNPGASSKSEASEGNTKRSVCSRCLQMINENNKIEIDKQAFHSHCAKCYF 498
           C   G+   G + GA++  E  +G  KRSV ++ +   +++N  EIDKQ   + C  C F
Sbjct: 100 CSVCGDKSTGLHYGAAT-CEGCKGFFKRSVQNKKVYHCSQDNCCEIDKQN-RNRCQSCRF 157

Query: 499 CHTVHRPTSTSAM 537
              + +   T A+
Sbjct: 158 RKCISKGMLTEAV 170


>AF273835-1|AAG15183.1|  476|Caenorhabditis elegans nuclear receptor
           NHR-91 protein.
          Length = 476

 Score = 32.7 bits (71), Expect = 0.25
 Identities = 22/73 (30%), Positives = 37/73 (50%)
 Frame = +1

Query: 319 CGKFGNGQEGDNPGASSKSEASEGNTKRSVCSRCLQMINENNKIEIDKQAFHSHCAKCYF 498
           C   G+   G + GA++  E  +G  KRSV ++ +   +++N  EIDKQ   + C  C F
Sbjct: 102 CSVCGDKSTGLHYGAAT-CEGCKGFFKRSVQNKKVYHCSQDNCCEIDKQN-RNRCQSCRF 159

Query: 499 CHTVHRPTSTSAM 537
              + +   T A+
Sbjct: 160 RKCISKGMLTEAV 172


>AF273834-1|AAG15182.1|  475|Caenorhabditis elegans nuclear receptor
           NHR-91 protein.
          Length = 475

 Score = 32.7 bits (71), Expect = 0.25
 Identities = 22/73 (30%), Positives = 37/73 (50%)
 Frame = +1

Query: 319 CGKFGNGQEGDNPGASSKSEASEGNTKRSVCSRCLQMINENNKIEIDKQAFHSHCAKCYF 498
           C   G+   G + GA++  E  +G  KRSV ++ +   +++N  EIDKQ   + C  C F
Sbjct: 101 CSVCGDKSTGLHYGAAT-CEGCKGFFKRSVQNKKVYHCSQDNCCEIDKQN-RNRCQSCRF 158

Query: 499 CHTVHRPTSTSAM 537
              + +   T A+
Sbjct: 159 RKCISKGMLTEAV 171


>AF273833-1|AAG15181.1|  475|Caenorhabditis elegans nuclear receptor
           NHR-91 protein.
          Length = 475

 Score = 32.7 bits (71), Expect = 0.25
 Identities = 22/73 (30%), Positives = 37/73 (50%)
 Frame = +1

Query: 319 CGKFGNGQEGDNPGASSKSEASEGNTKRSVCSRCLQMINENNKIEIDKQAFHSHCAKCYF 498
           C   G+   G + GA++  E  +G  KRSV ++ +   +++N  EIDKQ   + C  C F
Sbjct: 101 CSVCGDKSTGLHYGAAT-CEGCKGFFKRSVQNKKVYHCSQDNCCEIDKQN-RNRCQSCRF 158

Query: 499 CHTVHRPTSTSAM 537
              + +   T A+
Sbjct: 159 RKCISKGMLTEAV 171


>Z47811-3|CAA87787.2|  723|Caenorhabditis elegans Hypothetical
           protein K02C4.4 protein.
          Length = 723

 Score = 31.5 bits (68), Expect = 0.59
 Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 2/41 (4%)
 Frame = +1

Query: 391 NTKRSVCSRCLQMINENNKIEI--DKQAFHSHCAKCYFCHT 507
           N+K+  C+RC + +   +K+    D   FH  C KCY C T
Sbjct: 2   NSKQH-CNRCGKQVYPTDKVGPLKDSTFFHQGCFKCYICGT 41


>AF489839-1|AAN09795.1|  723|Caenorhabditis elegans lim and
           transglutaminase domainprotein protein.
          Length = 723

 Score = 31.5 bits (68), Expect = 0.59
 Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 2/41 (4%)
 Frame = +1

Query: 391 NTKRSVCSRCLQMINENNKIEI--DKQAFHSHCAKCYFCHT 507
           N+K+  C+RC + +   +K+    D   FH  C KCY C T
Sbjct: 2   NSKQH-CNRCGKQVYPTDKVGPLKDSTFFHQGCFKCYICGT 41


>Z81054-4|CAB02885.3|  321|Caenorhabditis elegans Hypothetical
           protein F01D4.6a protein.
          Length = 321

 Score = 30.3 bits (65), Expect = 1.4
 Identities = 9/33 (27%), Positives = 18/33 (54%)
 Frame = +1

Query: 409 CSRCLQMINENNKIEIDKQAFHSHCAKCYFCHT 507
           C+ C + I +     +D +++H +C KC  C +
Sbjct: 29  CNCCNEQIYDRYIYRMDNRSYHENCVKCTICES 61


>L02877-1|AAA50614.1|  321|Caenorhabditis elegans homeoprotein
           protein.
          Length = 321

 Score = 30.3 bits (65), Expect = 1.4
 Identities = 9/33 (27%), Positives = 18/33 (54%)
 Frame = +1

Query: 409 CSRCLQMINENNKIEIDKQAFHSHCAKCYFCHT 507
           C+ C + I +     +D +++H +C KC  C +
Sbjct: 29  CNCCNEQIYDRYIYRMDNRSYHENCVKCTICES 61


>U41021-4|AAA82334.1|  348|Caenorhabditis elegans Uncoordinated
           protein 97 protein.
          Length = 348

 Score = 29.9 bits (64), Expect = 1.8
 Identities = 12/35 (34%), Positives = 19/35 (54%)
 Frame = +1

Query: 400 RSVCSRCLQMINENNKIEIDKQAFHSHCAKCYFCH 504
           R VC +C  MI++   I+    +FH +  KC  C+
Sbjct: 143 RYVCHKCHAMIDDGQHIKFRGDSFHPYHFKCKRCN 177


>AF035583-1|AAD09435.1|  348|Caenorhabditis elegans UNC-97 protein.
          Length = 348

 Score = 29.9 bits (64), Expect = 1.8
 Identities = 12/35 (34%), Positives = 19/35 (54%)
 Frame = +1

Query: 400 RSVCSRCLQMINENNKIEIDKQAFHSHCAKCYFCH 504
           R VC +C  MI++   I+    +FH +  KC  C+
Sbjct: 143 RYVCHKCHAMIDDGQHIKFRGDSFHPYHFKCKRCN 177


>U53149-4|AAA96120.1|  956|Caenorhabditis elegans Patched related
           family protein 1 protein.
          Length = 956

 Score = 28.7 bits (61), Expect = 4.1
 Identities = 15/41 (36%), Positives = 21/41 (51%)
 Frame = +1

Query: 481 CAKCYFCHTVHRPTSTSAMVKSSASLASNITSCTDIRTTPM 603
           CA+ +  +  H P        S A++A +ITS TDI T  M
Sbjct: 376 CAEWHRTNPQHSPEKRIGKTLSEAAVAISITSLTDIATFAM 416


>Z71181-9|CAD44140.1|  960|Caenorhabditis elegans Hypothetical
           protein B0024.14b protein.
          Length = 960

 Score = 28.3 bits (60), Expect = 5.5
 Identities = 12/22 (54%), Positives = 14/22 (63%), Gaps = 4/22 (18%)
 Frame = -2

Query: 628 CSKHCL----KNSLGLSLCRCK 575
           C KHCL     NS G SLC+C+
Sbjct: 463 CHKHCLYGFETNSAGCSLCKCR 484


>Z71178-18|CAH04640.1|  671|Caenorhabditis elegans Hypothetical
           protein B0024.14e protein.
          Length = 671

 Score = 28.3 bits (60), Expect = 5.5
 Identities = 12/22 (54%), Positives = 14/22 (63%), Gaps = 4/22 (18%)
 Frame = -2

Query: 628 CSKHCL----KNSLGLSLCRCK 575
           C KHCL     NS G SLC+C+
Sbjct: 397 CHKHCLYGFETNSAGCSLCKCR 418


>Z71178-17|CAD44089.1|  898|Caenorhabditis elegans Hypothetical
           protein B0024.14d protein.
          Length = 898

 Score = 28.3 bits (60), Expect = 5.5
 Identities = 12/22 (54%), Positives = 14/22 (63%), Gaps = 4/22 (18%)
 Frame = -2

Query: 628 CSKHCL----KNSLGLSLCRCK 575
           C KHCL     NS G SLC+C+
Sbjct: 397 CHKHCLYGFETNSAGCSLCKCR 418


>Z71178-15|CAD44087.1|  960|Caenorhabditis elegans Hypothetical
           protein B0024.14b protein.
          Length = 960

 Score = 28.3 bits (60), Expect = 5.5
 Identities = 12/22 (54%), Positives = 14/22 (63%), Gaps = 4/22 (18%)
 Frame = -2

Query: 628 CSKHCL----KNSLGLSLCRCK 575
           C KHCL     NS G SLC+C+
Sbjct: 463 CHKHCLYGFETNSAGCSLCKCR 484


>Z71178-14|CAA94886.3|  894|Caenorhabditis elegans Hypothetical
           protein B0024.14a protein.
          Length = 894

 Score = 28.3 bits (60), Expect = 5.5
 Identities = 12/22 (54%), Positives = 14/22 (63%), Gaps = 4/22 (18%)
 Frame = -2

Query: 628 CSKHCL----KNSLGLSLCRCK 575
           C KHCL     NS G SLC+C+
Sbjct: 397 CHKHCLYGFETNSAGCSLCKCR 418


>U55375-4|AAC69042.3|  287|Caenorhabditis elegans Lim domain family
           protein 6 protein.
          Length = 287

 Score = 28.3 bits (60), Expect = 5.5
 Identities = 10/43 (23%), Positives = 20/43 (46%)
 Frame = +1

Query: 373 SEASEGNTKRSVCSRCLQMINENNKIEIDKQAFHSHCAKCYFC 501
           S  +   T+  +CS C  +I +     + + ++H  C +C  C
Sbjct: 7   SATTSSTTEDKLCSGCGCLIKDRYIYRVMEDSYHESCLRCSCC 49


>U39471-2|AAA80131.1|   92|Caenorhabditis elegans Hypothetical
           protein T16D1.1 protein.
          Length = 92

 Score = 28.3 bits (60), Expect = 5.5
 Identities = 11/30 (36%), Positives = 18/30 (60%)
 Frame = +1

Query: 196 NSVGGEDVLRARILQWMLQAHVLDRFRGEC 285
           ++VG E+++  R  QW L  H+L  F+  C
Sbjct: 23  SNVGSEEIIEER-KQWTLDGHLLGHFQRRC 51


>AL021478-4|CAJ26240.1|  671|Caenorhabditis elegans Hypothetical
           protein B0024.14e protein.
          Length = 671

 Score = 28.3 bits (60), Expect = 5.5
 Identities = 12/22 (54%), Positives = 14/22 (63%), Gaps = 4/22 (18%)
 Frame = -2

Query: 628 CSKHCL----KNSLGLSLCRCK 575
           C KHCL     NS G SLC+C+
Sbjct: 397 CHKHCLYGFETNSAGCSLCKCR 418


>AL021478-3|CAF32233.1|  898|Caenorhabditis elegans Hypothetical
           protein B0024.14d protein.
          Length = 898

 Score = 28.3 bits (60), Expect = 5.5
 Identities = 12/22 (54%), Positives = 14/22 (63%), Gaps = 4/22 (18%)
 Frame = -2

Query: 628 CSKHCL----KNSLGLSLCRCK 575
           C KHCL     NS G SLC+C+
Sbjct: 397 CHKHCLYGFETNSAGCSLCKCR 418


>AL021478-1|CAC35857.2|  894|Caenorhabditis elegans Hypothetical
           protein B0024.14a protein.
          Length = 894

 Score = 28.3 bits (60), Expect = 5.5
 Identities = 12/22 (54%), Positives = 14/22 (63%), Gaps = 4/22 (18%)
 Frame = -2

Query: 628 CSKHCL----KNSLGLSLCRCK 575
           C KHCL     NS G SLC+C+
Sbjct: 397 CHKHCLYGFETNSAGCSLCKCR 418


>U67951-2|AAB07570.2|  302|Caenorhabditis elegans Regulator of
           fusion protein 2,isoform a protein.
          Length = 302

 Score = 27.9 bits (59), Expect = 7.2
 Identities = 11/29 (37%), Positives = 16/29 (55%), Gaps = 1/29 (3%)
 Frame = +3

Query: 564 QH-HVLHRHKDNPNEFFKQCFEQFADPRF 647
           QH H +H   D PN F +    QF++P +
Sbjct: 264 QHLHTMHTFMDRPNPFMQMYQNQFSNPTY 292


>U67951-1|AAQ65207.1|  315|Caenorhabditis elegans Regulator of
           fusion protein 2,isoform b protein.
          Length = 315

 Score = 27.9 bits (59), Expect = 7.2
 Identities = 11/29 (37%), Positives = 16/29 (55%), Gaps = 1/29 (3%)
 Frame = +3

Query: 564 QH-HVLHRHKDNPNEFFKQCFEQFADPRF 647
           QH H +H   D PN F +    QF++P +
Sbjct: 277 QHLHTMHTFMDRPNPFMQMYQNQFSNPTY 305


>U58751-9|AAB00660.1|  133|Caenorhabditis elegans Hypothetical
           protein C07G1.6 protein.
          Length = 133

 Score = 27.9 bits (59), Expect = 7.2
 Identities = 16/49 (32%), Positives = 21/49 (42%)
 Frame = +1

Query: 430 INENNKIEIDKQAFHSHCAKCYFCHTVHRPTSTSAMVKSSASLASNITS 576
           +N N  +       H   AK  F HT H P    A   S+++ AS  TS
Sbjct: 23  VNMNVVVNFFTGLDHYEYAKLRFAHTAHTPPLIRASSTSASASASTSTS 71


>AY115477-1|AAM55473.1|  303|Caenorhabditis elegans zinc finger
           protein REF-2 protein.
          Length = 303

 Score = 27.9 bits (59), Expect = 7.2
 Identities = 11/29 (37%), Positives = 16/29 (55%), Gaps = 1/29 (3%)
 Frame = +3

Query: 564 QH-HVLHRHKDNPNEFFKQCFEQFADPRF 647
           QH H +H   D PN F +    QF++P +
Sbjct: 265 QHLHTMHTFMDRPNPFMQMYQNQFSNPTY 293


>Z54237-10|CAJ43909.1|  684|Caenorhabditis elegans Hypothetical
           protein T11B7.4e protein.
          Length = 684

 Score = 27.5 bits (58), Expect = 9.6
 Identities = 9/16 (56%), Positives = 11/16 (68%)
 Frame = +3

Query: 537 GQVFCEPCFQHHVLHR 584
           GQ FCE CF+ H+  R
Sbjct: 556 GQKFCESCFEQHIAPR 571


>Z54237-9|CAA90991.1| 1424|Caenorhabditis elegans Hypothetical protein
            T11B7.4d protein.
          Length = 1424

 Score = 27.5 bits (58), Expect = 9.6
 Identities = 9/16 (56%), Positives = 11/16 (68%)
 Frame = +3

Query: 537  GQVFCEPCFQHHVLHR 584
            GQ FCE CF+ H+  R
Sbjct: 1296 GQKFCESCFEQHIAPR 1311


>Z54237-8|CAE52902.1|  771|Caenorhabditis elegans Hypothetical
           protein T11B7.4c protein.
          Length = 771

 Score = 27.5 bits (58), Expect = 9.6
 Identities = 9/16 (56%), Positives = 11/16 (68%)
 Frame = +3

Query: 537 GQVFCEPCFQHHVLHR 584
           GQ FCE CF+ H+  R
Sbjct: 643 GQKFCESCFEQHIAPR 658


>Z54237-7|CAB54312.2|  645|Caenorhabditis elegans Hypothetical
           protein T11B7.4b protein.
          Length = 645

 Score = 27.5 bits (58), Expect = 9.6
 Identities = 9/16 (56%), Positives = 11/16 (68%)
 Frame = +3

Query: 537 GQVFCEPCFQHHVLHR 584
           GQ FCE CF+ H+  R
Sbjct: 517 GQKFCESCFEQHIAPR 532


>Z54235-13|CAJ43902.1|  684|Caenorhabditis elegans Hypothetical
           protein T11B7.4e protein.
          Length = 684

 Score = 27.5 bits (58), Expect = 9.6
 Identities = 9/16 (56%), Positives = 11/16 (68%)
 Frame = +3

Query: 537 GQVFCEPCFQHHVLHR 584
           GQ FCE CF+ H+  R
Sbjct: 556 GQKFCESCFEQHIAPR 571


>Z54235-11|CAA90978.1| 1424|Caenorhabditis elegans Hypothetical
            protein T11B7.4d protein.
          Length = 1424

 Score = 27.5 bits (58), Expect = 9.6
 Identities = 9/16 (56%), Positives = 11/16 (68%)
 Frame = +3

Query: 537  GQVFCEPCFQHHVLHR 584
            GQ FCE CF+ H+  R
Sbjct: 1296 GQKFCESCFEQHIAPR 1311


>Z54235-10|CAE52905.1|  771|Caenorhabditis elegans Hypothetical
           protein T11B7.4c protein.
          Length = 771

 Score = 27.5 bits (58), Expect = 9.6
 Identities = 9/16 (56%), Positives = 11/16 (68%)
 Frame = +3

Query: 537 GQVFCEPCFQHHVLHR 584
           GQ FCE CF+ H+  R
Sbjct: 643 GQKFCESCFEQHIAPR 658


>Z54235-9|CAB54190.2|  645|Caenorhabditis elegans Hypothetical
           protein T11B7.4b protein.
          Length = 645

 Score = 27.5 bits (58), Expect = 9.6
 Identities = 9/16 (56%), Positives = 11/16 (68%)
 Frame = +3

Query: 537 GQVFCEPCFQHHVLHR 584
           GQ FCE CF+ H+  R
Sbjct: 517 GQKFCESCFEQHIAPR 532


>AF353303-1|AAK32717.1|  367|Caenorhabditis elegans GATA-like
           transcription factorELT-6 protein.
          Length = 367

 Score = 27.5 bits (58), Expect = 9.6
 Identities = 13/53 (24%), Positives = 23/53 (43%)
 Frame = +1

Query: 361 ASSKSEASEGNTKRSVCSRCLQMINENNKIEIDKQAFHSHCAKCYFCHTVHRP 519
           A S  + +  N+  S CS C  +     + +++ +   + C   Y  H  HRP
Sbjct: 249 AGSSEDDTSANSSISKCSNCSTIKTTAWRRDLEGKLVCNACGLYYRLHRTHRP 301


>AF100657-1|AAC68957.3|  367|Caenorhabditis elegans Erythroid-like
           transcription factorfamily protein 6 protein.
          Length = 367

 Score = 27.5 bits (58), Expect = 9.6
 Identities = 13/53 (24%), Positives = 23/53 (43%)
 Frame = +1

Query: 361 ASSKSEASEGNTKRSVCSRCLQMINENNKIEIDKQAFHSHCAKCYFCHTVHRP 519
           A S  + +  N+  S CS C  +     + +++ +   + C   Y  H  HRP
Sbjct: 249 AGSSEDDTSANSSISKCSNCSTIKTTAWRRDLEGKLVCNACGLYYRLHRTHRP 301


>AC024776-3|AAK68466.1|  453|Caenorhabditis elegans Hypothetical
           protein Y41D4B.16 protein.
          Length = 453

 Score = 27.5 bits (58), Expect = 9.6
 Identities = 14/36 (38%), Positives = 19/36 (52%)
 Frame = +1

Query: 493 YFCHTVHRPTSTSAMVKSSASLASNITSCTDIRTTP 600
           YF      PT+TSA + S+AS  S  ++ T   T P
Sbjct: 357 YFNMDTGAPTTTSAALSSTASTPSIASTATSAATNP 392


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,637,017
Number of Sequences: 27780
Number of extensions: 358329
Number of successful extensions: 1078
Number of sequences better than 10.0: 39
Number of HSP's better than 10.0 without gapping: 1023
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1078
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1581836700
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -