SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B08
         (510 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z81095-2|CAB03157.1|   65|Caenorhabditis elegans Hypothetical pr...    91   3e-19
AF047660-4|AAM54169.1|   63|Caenorhabditis elegans Hypothetical ...    88   4e-18
Z83125-5|CAB05622.2|  362|Caenorhabditis elegans Hypothetical pr...    29   2.0  
Z77661-11|CAB01190.2| 1099|Caenorhabditis elegans Hypothetical p...    29   2.0  
U40799-2|AAA81480.1|  712|Caenorhabditis elegans Hypothetical pr...    28   3.4  
Z81583-4|CAB04669.1|  323|Caenorhabditis elegans Hypothetical pr...    28   4.5  

>Z81095-2|CAB03157.1|   65|Caenorhabditis elegans Hypothetical
           protein F59F4.2 protein.
          Length = 65

 Score = 91.5 bits (217), Expect = 3e-19
 Identities = 39/63 (61%), Positives = 51/63 (80%)
 Frame = +1

Query: 100 MAPKQRMRIANEIASKNITMRGNVPKTTKEKEDQYPVAPWLLALFIFVVCGSAVFQIIQS 279
           MAPKQRM +AN+  SKN+  RGNV K+ K  ED+YP APWL+ LF+FVVCGSAVF+II+ 
Sbjct: 1   MAPKQRMTLANKQFSKNVNNRGNVAKSLKPAEDKYPAAPWLIGLFVFVVCGSAVFEIIRY 60

Query: 280 IRL 288
           +++
Sbjct: 61  VKM 63


>AF047660-4|AAM54169.1|   63|Caenorhabditis elegans Hypothetical
           protein T09A12.5 protein.
          Length = 63

 Score = 87.8 bits (208), Expect = 4e-18
 Identities = 37/63 (58%), Positives = 49/63 (77%)
 Frame = +1

Query: 100 MAPKQRMRIANEIASKNITMRGNVPKTTKEKEDQYPVAPWLLALFIFVVCGSAVFQIIQS 279
           MAPKQRM +AN   SKN+T RGNVPK  K  E ++P + WL+ LFIFVVCGSA+F++I+ 
Sbjct: 1   MAPKQRMAVANAQFSKNVTQRGNVPKGNKTNESKFPTSQWLIGLFIFVVCGSAIFEVIRY 60

Query: 280 IRL 288
           I++
Sbjct: 61  IKV 63


>Z83125-5|CAB05622.2|  362|Caenorhabditis elegans Hypothetical
           protein T15D6.6 protein.
          Length = 362

 Score = 29.1 bits (62), Expect = 2.0
 Identities = 11/29 (37%), Positives = 19/29 (65%)
 Frame = -3

Query: 88  IKYICQFNNKLKGLEEPQRAISLDT*IKV 2
           I+Y+C+ NN+ KG+ +  RA   D  +K+
Sbjct: 44  IRYLCEKNNQCKGMRKNCRACRFDYCVKI 72


>Z77661-11|CAB01190.2| 1099|Caenorhabditis elegans Hypothetical
           protein F40G12.3 protein.
          Length = 1099

 Score = 29.1 bits (62), Expect = 2.0
 Identities = 12/24 (50%), Positives = 15/24 (62%), Gaps = 2/24 (8%)
 Frame = +3

Query: 255 CCVPD--NPINKTSLNHEDNWRTA 320
           CC P+  N +N  S+ H  NWRTA
Sbjct: 136 CCFPEVVNYLNTHSVGHVKNWRTA 159


>U40799-2|AAA81480.1|  712|Caenorhabditis elegans Hypothetical
           protein F42C5.4 protein.
          Length = 712

 Score = 28.3 bits (60), Expect = 3.4
 Identities = 16/62 (25%), Positives = 28/62 (45%), Gaps = 1/62 (1%)
 Frame = +3

Query: 168 CTQNYQGKRRPISCGTLAPCSLHLRSVWLCCVPDNPINKTSLNHEDNW-RTAIENTIK*Q 344
           C+  +   ++P  C T   C L  + + +C VP + I +     ++ W R   E T K +
Sbjct: 113 CSHCHNDAKKPRFCVT---CGLQKKYLMMCRVPKDGIERDDAEEQEEWKRRQEEETRKSK 169

Query: 345 HY 350
            Y
Sbjct: 170 KY 171


>Z81583-4|CAB04669.1|  323|Caenorhabditis elegans Hypothetical
           protein T02G6.4 protein.
          Length = 323

 Score = 27.9 bits (59), Expect = 4.5
 Identities = 11/26 (42%), Positives = 14/26 (53%)
 Frame = +3

Query: 240 RSVWLCCVPDNPINKTSLNHEDNWRT 317
           RS+W CC+P    N  S   +  WRT
Sbjct: 275 RSMWSCCIPTTYYNNYSNALKIAWRT 300


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,877,378
Number of Sequences: 27780
Number of extensions: 250723
Number of successful extensions: 615
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 603
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 615
length of database: 12,740,198
effective HSP length: 76
effective length of database: 10,628,918
effective search space used: 988489374
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -