SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120036.Seq
         (735 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AL117195-14|CAB55024.1|  140|Caenorhabditis elegans Hypothetical...    29   2.6  
Z81473-8|CAB03899.2|  418|Caenorhabditis elegans Hypothetical pr...    29   4.5  
Z81473-4|CAB03891.1|  463|Caenorhabditis elegans Hypothetical pr...    29   4.5  
U39995-3|AAF99995.2|  572|Caenorhabditis elegans Hypothetical pr...    29   4.5  
AL031636-1|CAA21046.2|  418|Caenorhabditis elegans Hypothetical ...    29   4.5  
Z99281-15|CAB16528.1|  199|Caenorhabditis elegans Hypothetical p...    28   7.9  

>AL117195-14|CAB55024.1|  140|Caenorhabditis elegans Hypothetical
           protein Y57A10A.21 protein.
          Length = 140

 Score = 29.5 bits (63), Expect = 2.6
 Identities = 12/20 (60%), Positives = 14/20 (70%)
 Frame = -1

Query: 117 KTFFELFHKNVCFRKKNTPF 58
           KTFFE F + +CF KKN  F
Sbjct: 17  KTFFEHFPEKLCFSKKNWAF 36


>Z81473-8|CAB03899.2|  418|Caenorhabditis elegans Hypothetical
           protein Y47H9A.1 protein.
          Length = 418

 Score = 28.7 bits (61), Expect = 4.5
 Identities = 16/38 (42%), Positives = 19/38 (50%)
 Frame = +1

Query: 256 RSIPESEDKIGDKLDLKKSTKTVPKVFYTARNVISIVN 369
           R IPE +  IG  LDLK   K+V KV      +  I N
Sbjct: 309 REIPEKKGNIGWALDLKIDGKSVEKVVIRMIGIEEIAN 346


>Z81473-4|CAB03891.1|  463|Caenorhabditis elegans Hypothetical
           protein C17D12.3 protein.
          Length = 463

 Score = 28.7 bits (61), Expect = 4.5
 Identities = 16/38 (42%), Positives = 19/38 (50%)
 Frame = +1

Query: 256 RSIPESEDKIGDKLDLKKSTKTVPKVFYTARNVISIVN 369
           R IPE +  IG  LDLK   K+V KV      +  I N
Sbjct: 309 REIPEKKGNIGWALDLKIDGKSVEKVVIRMIGIEEIAN 346


>U39995-3|AAF99995.2|  572|Caenorhabditis elegans Hypothetical
           protein M60.2 protein.
          Length = 572

 Score = 28.7 bits (61), Expect = 4.5
 Identities = 11/36 (30%), Positives = 20/36 (55%)
 Frame = +1

Query: 358 SIVN*RAETTGSKVKRGGGYFSFHCWFSKITRTCIN 465
           ++VN  A   G  ++   G F++H WF+K+    I+
Sbjct: 179 TVVNRFANWVGFYIQENAGKFNYHGWFTKLNGIAID 214


>AL031636-1|CAA21046.2|  418|Caenorhabditis elegans Hypothetical
           protein Y47H9A.1 protein.
          Length = 418

 Score = 28.7 bits (61), Expect = 4.5
 Identities = 16/38 (42%), Positives = 19/38 (50%)
 Frame = +1

Query: 256 RSIPESEDKIGDKLDLKKSTKTVPKVFYTARNVISIVN 369
           R IPE +  IG  LDLK   K+V KV      +  I N
Sbjct: 309 REIPEKKGNIGWALDLKIDGKSVEKVVIRMIGIEEIAN 346


>Z99281-15|CAB16528.1|  199|Caenorhabditis elegans Hypothetical
           protein Y57G11C.25 protein.
          Length = 199

 Score = 27.9 bits (59), Expect = 7.9
 Identities = 15/29 (51%), Positives = 19/29 (65%), Gaps = 2/29 (6%)
 Frame = -2

Query: 164 VCYNHFSLNSVNSSTTKRF--SNCSTKTF 84
           +C NHF   S +SSTT++   SN ST TF
Sbjct: 169 LCLNHFEA-STSSSTTQKLTSSNLSTSTF 196


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,128,887
Number of Sequences: 27780
Number of extensions: 326170
Number of successful extensions: 811
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 795
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 811
length of database: 12,740,198
effective HSP length: 80
effective length of database: 10,517,798
effective search space used: 1724918872
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -