SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30101.Seq
         (454 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U15955-1|AAA67443.1|   95|Apis mellifera defensin precursor prot...    23   1.6  
AY496432-1|AAS75803.1|   95|Apis mellifera defensin/royalisin pr...    23   1.6  
AY273778-1|AAP33487.1|  427|Apis mellifera ultraspiracle protein...    21   6.3  
AF263459-1|AAF73057.1|  427|Apis mellifera ultraspiracle protein...    21   6.3  

>U15955-1|AAA67443.1|   95|Apis mellifera defensin precursor
           protein.
          Length = 95

 Score = 23.0 bits (47), Expect = 1.6
 Identities = 11/32 (34%), Positives = 17/32 (53%)
 Frame = +3

Query: 33  LLFCAMCILVYGNSEDDFCEIDSIEQEDPCRR 128
           LLF AM  ++    ED+F  ++  E E+   R
Sbjct: 9   LLFMAMVAIMAAPVEDEFEPLEHFENEERADR 40


>AY496432-1|AAS75803.1|   95|Apis mellifera defensin/royalisin
           precursor protein.
          Length = 95

 Score = 23.0 bits (47), Expect = 1.6
 Identities = 11/32 (34%), Positives = 17/32 (53%)
 Frame = +3

Query: 33  LLFCAMCILVYGNSEDDFCEIDSIEQEDPCRR 128
           LLF AM  ++    ED+F  ++  E E+   R
Sbjct: 9   LLFMAMVAIMAAPVEDEFEPLEHFENEERADR 40


>AY273778-1|AAP33487.1|  427|Apis mellifera ultraspiracle protein
           protein.
          Length = 427

 Score = 21.0 bits (42), Expect = 6.3
 Identities = 7/19 (36%), Positives = 13/19 (68%)
 Frame = -2

Query: 375 TVYCYTKIQQSXPSGQSEA 319
           T  C++ +  + PSGQ++A
Sbjct: 75  TAGCHSNLLSTSPSGQNKA 93


>AF263459-1|AAF73057.1|  427|Apis mellifera ultraspiracle protein
           protein.
          Length = 427

 Score = 21.0 bits (42), Expect = 6.3
 Identities = 7/19 (36%), Positives = 13/19 (68%)
 Frame = -2

Query: 375 TVYCYTKIQQSXPSGQSEA 319
           T  C++ +  + PSGQ++A
Sbjct: 75  TAGCHSNLLSTSPSGQNKA 93


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 105,585
Number of Sequences: 438
Number of extensions: 2088
Number of successful extensions: 4
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 146,343
effective HSP length: 53
effective length of database: 123,129
effective search space used: 11943513
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.2 bits)

- SilkBase 1999-2022 -