SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= msgV0030.Seq
         (329 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB253416-1|BAE86927.1|  580|Apis mellifera alpha-glucosidase pro...    21   3.9  
DQ071552-1|AAY82248.1|  495|Apis mellifera anarchy 1 protein.          20   8.9  

>AB253416-1|BAE86927.1|  580|Apis mellifera alpha-glucosidase
           protein.
          Length = 580

 Score = 21.0 bits (42), Expect = 3.9
 Identities = 13/33 (39%), Positives = 20/33 (60%), Gaps = 4/33 (12%)
 Frame = +1

Query: 187 KALRYVEN----VSXSXELNLIDGVSLSVKAXL 273
           K+L Y++      + S E+++IDG  LSVK  L
Sbjct: 470 KSLSYLKKQPVIANGSLEVDVIDGRVLSVKREL 502


>DQ071552-1|AAY82248.1|  495|Apis mellifera anarchy 1 protein.
          Length = 495

 Score = 19.8 bits (39), Expect = 8.9
 Identities = 7/11 (63%), Positives = 9/11 (81%)
 Frame = +2

Query: 92  WPQRIVTKTSS 124
           WP++ VTK SS
Sbjct: 222 WPKKRVTKMSS 232


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.312    0.131    0.364 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 83,921
Number of Sequences: 438
Number of extensions: 1224
Number of successful extensions: 2
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2
length of database: 146,343
effective HSP length: 50
effective length of database: 124,443
effective search space used:  7342137
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.2 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 39 (20.5 bits)

- SilkBase 1999-2023 -