SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A08
         (614 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF388659-3|AAK71993.1|  548|Apis mellifera 1D-myo-inositol-trisp...    24   1.4  
AF388659-2|AAK71994.1|  463|Apis mellifera 1D-myo-inositol-trisp...    24   1.4  
AF388659-1|AAK71995.1|  782|Apis mellifera 1D-myo-inositol-trisp...    24   1.4  
DQ342041-1|ABC69933.1|  828|Apis mellifera STIP protein.               23   2.4  
D79207-1|BAA23639.1|  432|Apis mellifera milk protein protein.         23   3.1  
AF388203-1|AAM73637.1|  432|Apis mellifera major royal jelly pro...    23   3.1  
AF000633-1|AAC61895.1|  432|Apis mellifera major royal jelly pro...    23   3.1  
AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul...    22   4.1  
AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A...    22   4.1  
DQ026037-1|AAY87896.1|  431|Apis mellifera nicotinic acetylcholi...    21   7.2  
Z26319-1|CAA81228.1|  464|Apis mellifera royal jelly protein RJP...    21   9.6  

>AF388659-3|AAK71993.1|  548|Apis mellifera
           1D-myo-inositol-trisphosphate 3-kinaseisoform C protein.
          Length = 548

 Score = 23.8 bits (49), Expect = 1.4
 Identities = 10/39 (25%), Positives = 22/39 (56%)
 Frame = +3

Query: 252 KTVKKDKDADNLLDQYEDYEPAEYQEVLYNEDRPCPRDC 368
           +T +KD  +D+++ +       + Q++L + + PC  DC
Sbjct: 309 ETHQKDGSSDSVIKRTVVSSYLQLQDLLGDFEHPCVMDC 347



 Score = 21.0 bits (42), Expect = 9.6
 Identities = 10/41 (24%), Positives = 21/41 (51%)
 Frame = +1

Query: 298 MRITNPRNTKRFCTTRTGPVPETAYALYLRGYRQAKCSFLE 420
           +++ +  ++K F TTRT      A   ++ GY  A   +++
Sbjct: 419 IKLAHGGSSKDFKTTRTREQVTEALRRFVEGYPHAVPKYIQ 459


>AF388659-2|AAK71994.1|  463|Apis mellifera
           1D-myo-inositol-trisphosphate 3-kinaseisoform B protein.
          Length = 463

 Score = 23.8 bits (49), Expect = 1.4
 Identities = 10/39 (25%), Positives = 22/39 (56%)
 Frame = +3

Query: 252 KTVKKDKDADNLLDQYEDYEPAEYQEVLYNEDRPCPRDC 368
           +T +KD  +D+++ +       + Q++L + + PC  DC
Sbjct: 224 ETHQKDGSSDSVIKRTVVSSYLQLQDLLGDFEHPCVMDC 262



 Score = 21.0 bits (42), Expect = 9.6
 Identities = 10/41 (24%), Positives = 21/41 (51%)
 Frame = +1

Query: 298 MRITNPRNTKRFCTTRTGPVPETAYALYLRGYRQAKCSFLE 420
           +++ +  ++K F TTRT      A   ++ GY  A   +++
Sbjct: 334 IKLAHGGSSKDFKTTRTREQVTEALRRFVEGYPHAVPKYIQ 374


>AF388659-1|AAK71995.1|  782|Apis mellifera
           1D-myo-inositol-trisphosphate 3-kinaseisoform A protein.
          Length = 782

 Score = 23.8 bits (49), Expect = 1.4
 Identities = 10/39 (25%), Positives = 22/39 (56%)
 Frame = +3

Query: 252 KTVKKDKDADNLLDQYEDYEPAEYQEVLYNEDRPCPRDC 368
           +T +KD  +D+++ +       + Q++L + + PC  DC
Sbjct: 543 ETHQKDGSSDSVIKRTVVSSYLQLQDLLGDFEHPCVMDC 581



 Score = 21.0 bits (42), Expect = 9.6
 Identities = 10/41 (24%), Positives = 21/41 (51%)
 Frame = +1

Query: 298 MRITNPRNTKRFCTTRTGPVPETAYALYLRGYRQAKCSFLE 420
           +++ +  ++K F TTRT      A   ++ GY  A   +++
Sbjct: 653 IKLAHGGSSKDFKTTRTREQVTEALRRFVEGYPHAVPKYIQ 693


>DQ342041-1|ABC69933.1|  828|Apis mellifera STIP protein.
          Length = 828

 Score = 23.0 bits (47), Expect = 2.4
 Identities = 17/57 (29%), Positives = 31/57 (54%), Gaps = 2/57 (3%)
 Frame = +3

Query: 240 ESINKTVKKDKDA-DNLLDQY-EDYEPAEYQEVLYNEDRPCPRDCICSVSQGIQTSQ 404
           E+   T+++  DA  +L D+Y E+Y+  E  E+  +   P  +DC+ S +  +Q  Q
Sbjct: 385 ETNQLTLQETADAFKDLQDKYYEEYKMYELGELASSFVGPKVKDCLISWNPLMQPKQ 441


>D79207-1|BAA23639.1|  432|Apis mellifera milk protein protein.
          Length = 432

 Score = 22.6 bits (46), Expect = 3.1
 Identities = 11/29 (37%), Positives = 15/29 (51%)
 Frame = +3

Query: 243 SINKTVKKDKDADNLLDQYEDYEPAEYQE 329
           S+N   KK  D   LL  Y D+  A+Y +
Sbjct: 89  SLNVISKKVGDGGPLLQPYPDWSFAKYDD 117


>AF388203-1|AAM73637.1|  432|Apis mellifera major royal jelly
           protein MRJP1 protein.
          Length = 432

 Score = 22.6 bits (46), Expect = 3.1
 Identities = 11/29 (37%), Positives = 15/29 (51%)
 Frame = +3

Query: 243 SINKTVKKDKDADNLLDQYEDYEPAEYQE 329
           S+N   KK  D   LL  Y D+  A+Y +
Sbjct: 89  SLNVISKKVGDGGPLLQPYPDWSFAKYDD 117


>AF000633-1|AAC61895.1|  432|Apis mellifera major royal jelly
           protein MRJP1 protein.
          Length = 432

 Score = 22.6 bits (46), Expect = 3.1
 Identities = 11/29 (37%), Positives = 15/29 (51%)
 Frame = +3

Query: 243 SINKTVKKDKDADNLLDQYEDYEPAEYQE 329
           S+N   KK  D   LL  Y D+  A+Y +
Sbjct: 89  SLNVISKKVGDGGPLLQPYPDWSFAKYDD 117


>AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule
           AbsCAM-Ig7B protein.
          Length = 1923

 Score = 22.2 bits (45), Expect = 4.1
 Identities = 11/22 (50%), Positives = 15/22 (68%)
 Frame = -1

Query: 401 ACLYPLRYRAYAVSGTGPVLVV 336
           AC  P  YR YA +G+ P+LV+
Sbjct: 263 ACPTP-EYRWYAQTGSEPMLVL 283


>AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member
           AbsCAM-Ig7A protein.
          Length = 1919

 Score = 22.2 bits (45), Expect = 4.1
 Identities = 11/22 (50%), Positives = 15/22 (68%)
 Frame = -1

Query: 401 ACLYPLRYRAYAVSGTGPVLVV 336
           AC  P  YR YA +G+ P+LV+
Sbjct: 263 ACPTP-EYRWYAQTGSEPMLVL 283


>DQ026037-1|AAY87896.1|  431|Apis mellifera nicotinic acetylcholine
           receptor alpha9subunit protein.
          Length = 431

 Score = 21.4 bits (43), Expect = 7.2
 Identities = 8/17 (47%), Positives = 10/17 (58%)
 Frame = +1

Query: 211 SWQHARWYSANLSIKPS 261
           SW    W  ++LS KPS
Sbjct: 93  SWMTLMWTDSHLSWKPS 109


>Z26319-1|CAA81228.1|  464|Apis mellifera royal jelly protein
           RJP57-2 protein.
          Length = 464

 Score = 21.0 bits (42), Expect = 9.6
 Identities = 9/29 (31%), Positives = 15/29 (51%)
 Frame = +3

Query: 243 SINKTVKKDKDADNLLDQYEDYEPAEYQE 329
           S+N    K  +   LL  Y D+  A+Y++
Sbjct: 94  SLNVVSDKTGNGGRLLQPYPDWSFAKYED 122


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 168,515
Number of Sequences: 438
Number of extensions: 3854
Number of successful extensions: 21
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 18
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 21
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 18215697
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -