SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= e96h0002
         (431 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM050259-1|CAJ18340.1|  683|Apis mellifera putative H3K9 methylt...    21   5.9  
DQ244074-1|ABB36784.1|  517|Apis mellifera cytochrome P450 monoo...    21   7.8  

>AM050259-1|CAJ18340.1|  683|Apis mellifera putative H3K9
           methyltransferase protein.
          Length = 683

 Score = 21.0 bits (42), Expect = 5.9
 Identities = 11/30 (36%), Positives = 16/30 (53%)
 Frame = +3

Query: 273 SNGDINSAGDILTQNQQKGWWTIGLINSRY 362
           SNG  +S  D+L +  ++   TI   NS Y
Sbjct: 147 SNGSNSSNSDVLFKQNKEEEQTINRKNSDY 176


>DQ244074-1|ABB36784.1|  517|Apis mellifera cytochrome P450
           monooxygenase protein.
          Length = 517

 Score = 20.6 bits (41), Expect = 7.8
 Identities = 6/12 (50%), Positives = 6/12 (50%)
 Frame = -2

Query: 334 HHPFCWFWVRMS 299
           H P  WFW   S
Sbjct: 25  HRPAWWFWTATS 36


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 113,060
Number of Sequences: 438
Number of extensions: 2208
Number of successful extensions: 17
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 17
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 17
length of database: 146,343
effective HSP length: 52
effective length of database: 123,567
effective search space used: 11244597
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.2 bits)

- SilkBase 1999-2023 -