SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20037
         (718 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At3g09440.1 68416.m01121 heat shock cognate 70 kDa protein 3 (HS...   156   1e-38
At3g12580.1 68416.m01567 heat shock protein 70, putative / HSP70...   156   2e-38
At5g02500.1 68418.m00183 heat shock cognate 70 kDa protein 1 (HS...   155   4e-38
At1g56410.1 68414.m06487 heat shock cognate 70 kDa protein, puta...   154   5e-38
At1g16030.1 68414.m01924 heat shock protein 70, putative / HSP70...   154   6e-38
At5g02490.1 68418.m00182 heat shock cognate 70 kDa protein 2 (HS...   152   3e-37
At1g09080.1 68414.m01013 luminal binding protein 3 (BiP-3) (BP3)...   126   2e-29
At5g28540.1 68418.m03480 luminal binding protein 1 (BiP-1) (BP1)...   124   4e-29
At5g42020.2 68418.m05116 luminal binding protein 2 (BiP-2) (BP2)...   122   2e-28
At5g42020.1 68418.m05115 luminal binding protein 2 (BiP-2) (BP2)...   122   2e-28
At4g24280.1 68417.m03486 heat shock protein 70, putative / HSP70...   102   3e-22
At4g37910.1 68417.m05361 heat shock protein 70, mitochondrial, p...   101   5e-22
At5g49910.1 68418.m06180 heat shock protein 70 / HSP70 (HSC70-7)...   100   8e-22
At5g09590.1 68418.m01110 heat shock protein 70 / HSP70 (HSC70-5)...    99   1e-21
At1g11660.1 68414.m01339 heat shock protein, putative strong sim...    73   3e-13
At4g16660.1 68417.m02517 heat shock protein 70, putative / HSP70...    72   4e-13
At1g79930.1 68414.m09340 heat shock protein, putative contains P...    68   5e-12
At1g79920.2 68414.m09339 heat shock protein 70, putative / HSP70...    68   5e-12
At1g79920.1 68414.m09338 heat shock protein 70, putative / HSP70...    68   5e-12
At2g32120.2 68415.m03926 heat shock protein 70 family protein / ...    50   1e-06
At2g32120.1 68415.m03925 heat shock protein 70 family protein / ...    50   1e-06
At2g44330.1 68415.m05514 zinc finger (C3HC4-type RING finger) fa...    31   0.58 
At3g56940.1 68416.m06334 dicarboxylate diiron protein, putative ...    29   2.3  
At1g44446.3 68414.m05115 chlorophyll a oxygenase (CAO) / chlorop...    29   2.3  
At1g44446.2 68414.m05114 chlorophyll a oxygenase (CAO) / chlorop...    29   2.3  
At1g44446.1 68414.m05113 chlorophyll a oxygenase (CAO) / chlorop...    29   2.3  
At3g09000.1 68416.m01053 proline-rich family protein                   29   3.1  
At3g07760.2 68416.m00944 expressed protein                             29   3.1  
At3g07760.1 68416.m00943 expressed protein                             29   3.1  
At4g26820.1 68417.m03862 hypothetical protein                          29   4.1  
At1g19190.1 68414.m02389 expressed protein contains similarity t...    29   4.1  
At1g03080.1 68414.m00282 kinase interacting family protein simil...    29   4.1  
At1g73430.1 68414.m08500 sec34-like family protein contains Pfam...    28   5.4  
At1g69570.1 68414.m08001 Dof-type zinc finger domain-containing ...    28   5.4  
At3g54280.1 68416.m05999 SNF2 domain-containing protein / helica...    28   7.1  
At1g06850.1 68414.m00730 bZIP transcription factor, putative con...    28   7.1  
At2g42820.1 68415.m05301 abscisic acid-responsive HVA22 family p...    27   9.4  
At2g19910.1 68415.m02327 RNA-dependent RNA polymerase family pro...    27   9.4  

>At3g09440.1 68416.m01121 heat shock cognate 70 kDa protein 3
           (HSC70-3) (HSP70-3) identical to SP|O65719 Heat shock
           cognate 70 kDa protein 3 (Hsc70.3) {Arabidopsis
           thaliana}
          Length = 649

 Score =  156 bits (379), Expect = 1e-38
 Identities = 72/81 (88%), Positives = 78/81 (96%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           +NVLIFDLGGGTFDVS+LTIE+GIFEVK+TAGDTHLGGEDFDNRMVNHFVQEFKRK KKD
Sbjct: 199 KNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKNKKD 258

Query: 191 LATNKRALRRLRTACERAKRT 253
           ++ N RALRRLRTACERAKRT
Sbjct: 259 ISGNPRALRRLRTACERAKRT 279



 Score =  142 bits (344), Expect = 2e-34
 Identities = 69/88 (78%), Positives = 74/88 (84%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LSS+ Q +IEIDSLF+GIDFY  ITRARFEELN DLFR  MEPVEK LRDAKMDK  
Sbjct: 277 KRTLSSTAQTTIEIDSLFDGIDFYAPITRARFEELNIDLFRKCMEPVEKCLRDAKMDKNS 336

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           I D+VLVGGSTRIPKVQ+LL DFFNGKE
Sbjct: 337 IDDVVLVGGSTRIPKVQQLLVDFFNGKE 364



 Score = 68.5 bits (160), Expect = 4e-12
 Identities = 35/68 (51%), Positives = 41/68 (60%)
 Frame = +3

Query: 513 KSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKRNTTI 692
           KSINPDE           IL G+ +E+VQD           G+ETAGGVMT LI+RNTTI
Sbjct: 367 KSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIQRNTTI 426

Query: 693 PTKQTQTF 716
           PTK+ Q F
Sbjct: 427 PTKKEQVF 434


>At3g12580.1 68416.m01567 heat shock protein 70, putative / HSP70,
           putative strong similarity to heat shock protein
           GI:425194 [Spinacia oleracea]
          Length = 650

 Score =  156 bits (378), Expect = 2e-38
 Identities = 72/81 (88%), Positives = 77/81 (95%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           +NVLIFDLGGGTFDVS+LTIE+GIFEVK+TAGDTHLGGEDFDNRMVNHFVQEFKRK KKD
Sbjct: 199 KNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKNKKD 258

Query: 191 LATNKRALRRLRTACERAKRT 253
           +  N RALRRLRTACERAKRT
Sbjct: 259 ITGNPRALRRLRTACERAKRT 279



 Score =  153 bits (372), Expect = 8e-38
 Identities = 72/88 (81%), Positives = 79/88 (89%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LSS+ Q +IEIDSLFEGIDFYT+ITRARFEELN DLFR  MEPVEK LRDAKMDK+ 
Sbjct: 277 KRTLSSTAQTTIEIDSLFEGIDFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSS 336

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           +HD+VLVGGSTRIPKVQ+LLQDFFNGKE
Sbjct: 337 VHDVVLVGGSTRIPKVQQLLQDFFNGKE 364



 Score = 67.3 bits (157), Expect = 9e-12
 Identities = 35/68 (51%), Positives = 40/68 (58%)
 Frame = +3

Query: 513 KSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKRNTTI 692
           KSINPDE           IL G+ +E+VQD           G+ETAGGVMT LI RNTTI
Sbjct: 367 KSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTI 426

Query: 693 PTKQTQTF 716
           PTK+ Q F
Sbjct: 427 PTKKEQIF 434


>At5g02500.1 68418.m00183 heat shock cognate 70 kDa protein 1
           (HSC70-1) (HSP70-1) identical to SP|P22953 Heat shock
           cognate 70 kDa protein 1 (Hsc70.1) {Arabidopsis
           thaliana}
          Length = 651

 Score =  155 bits (375), Expect = 4e-38
 Identities = 71/81 (87%), Positives = 77/81 (95%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           +NVLIFDLGGGTFDVS+LTIE+GIFEVK+TAGDTHLGGEDFDNRMVNHFVQEFKRK KKD
Sbjct: 199 KNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKSKKD 258

Query: 191 LATNKRALRRLRTACERAKRT 253
           +  N RALRRLRT+CERAKRT
Sbjct: 259 ITGNPRALRRLRTSCERAKRT 279



 Score =  150 bits (364), Expect = 8e-37
 Identities = 70/88 (79%), Positives = 79/88 (89%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LSS+ Q +IEIDSL+EGIDFY++ITRARFEELN DLFR  MEPVEK LRDAKMDK+ 
Sbjct: 277 KRTLSSTAQTTIEIDSLYEGIDFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKST 336

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           +HD+VLVGGSTRIPKVQ+LLQDFFNGKE
Sbjct: 337 VHDVVLVGGSTRIPKVQQLLQDFFNGKE 364



 Score = 69.7 bits (163), Expect = 2e-12
 Identities = 36/68 (52%), Positives = 41/68 (60%)
 Frame = +3

Query: 513 KSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKRNTTI 692
           KSINPDE           IL G+ +E+VQD           G+ETAGGVMTTLI RNTTI
Sbjct: 367 KSINPDEAVAYGAAVQGAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTTLIPRNTTI 426

Query: 693 PTKQTQTF 716
           PTK+ Q F
Sbjct: 427 PTKKEQVF 434


>At1g56410.1 68414.m06487 heat shock cognate 70 kDa protein,
           putative / HSC70, putative / HSP70, putative strong
           similarity to heat shock cognate 70 kd protein 1
           SP:P22953 [Arabidopsis thaliana (Mouse-ear cress)]
          Length = 617

 Score =  154 bits (374), Expect = 5e-38
 Identities = 71/81 (87%), Positives = 78/81 (96%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           +NVLIFDLGGGTFDVS+LTIE+GIFEVK+TAGDTHLGGEDFDNRMVNHFVQEFKRK KKD
Sbjct: 199 KNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKNKKD 258

Query: 191 LATNKRALRRLRTACERAKRT 253
           ++ + RALRRLRTACERAKRT
Sbjct: 259 ISGDARALRRLRTACERAKRT 279



 Score =  144 bits (349), Expect = 5e-35
 Identities = 65/88 (73%), Positives = 77/88 (87%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LSS+ Q ++E+DSLFEGIDFY+ ITRA+FEE+N DLFR  MEPV K LRD+KMDK+ 
Sbjct: 277 KRTLSSTAQTTVEVDSLFEGIDFYSPITRAKFEEMNMDLFRKCMEPVMKCLRDSKMDKSM 336

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           +HD+VLVGGSTRIPKVQ+LLQDFFNGKE
Sbjct: 337 VHDVVLVGGSTRIPKVQQLLQDFFNGKE 364



 Score = 66.9 bits (156), Expect = 1e-11
 Identities = 35/68 (51%), Positives = 40/68 (58%)
 Frame = +3

Query: 513 KSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKRNTTI 692
           KSINPDE           IL G+ +E+VQD           GIET GGVMTTLI+RNTTI
Sbjct: 367 KSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGIETIGGVMTTLIQRNTTI 426

Query: 693 PTKQTQTF 716
           P K+ Q F
Sbjct: 427 PAKKEQEF 434


>At1g16030.1 68414.m01924 heat shock protein 70, putative / HSP70,
           putative similar to heat shock protein hsp70 GI:1771478
           from [Pisum sativum]
          Length = 646

 Score =  154 bits (373), Expect = 6e-38
 Identities = 69/81 (85%), Positives = 78/81 (96%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           +NVLIFDLGGGTFDVS+LTIE+G+FEVK+TAGDTHLGGEDFDNR+VNHFV EF+RK+KKD
Sbjct: 198 KNVLIFDLGGGTFDVSLLTIEEGVFEVKATAGDTHLGGEDFDNRLVNHFVAEFRRKHKKD 257

Query: 191 LATNKRALRRLRTACERAKRT 253
           +A N RALRRLRTACERAKRT
Sbjct: 258 IAGNARALRRLRTACERAKRT 278



 Score =  142 bits (343), Expect = 3e-34
 Identities = 64/88 (72%), Positives = 77/88 (87%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LSS+ Q +IEIDSL EGIDFY +I+RARFEE+N DLFR  M+PVEK L+DAK+DK+ 
Sbjct: 276 KRTLSSTAQTTIEIDSLHEGIDFYATISRARFEEMNMDLFRKCMDPVEKVLKDAKLDKSS 335

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           +HD+VLVGGSTRIPK+Q+LLQDFFNGKE
Sbjct: 336 VHDVVLVGGSTRIPKIQQLLQDFFNGKE 363



 Score = 65.7 bits (153), Expect = 3e-11
 Identities = 34/68 (50%), Positives = 39/68 (57%)
 Frame = +3

Query: 513 KSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKRNTTI 692
           KSINPDE           IL G+ SE+VQD           G+ETAGGVMT LI RNTT+
Sbjct: 366 KSINPDEAVAYGAAVQAAILTGEGSEKVQDLLLLDVAPLSLGLETAGGVMTVLIPRNTTV 425

Query: 693 PTKQTQTF 716
           P K+ Q F
Sbjct: 426 PCKKEQVF 433


>At5g02490.1 68418.m00182 heat shock cognate 70 kDa protein 2
           (HSC70-2) (HSP70-2) identical to SP|P22954 Heat shock
           cognate 70 kDa protein 2 (Hsc70.2) {Arabidopsis
           thaliana}
          Length = 653

 Score =  152 bits (368), Expect = 3e-37
 Identities = 70/81 (86%), Positives = 76/81 (93%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           +NVLIFDLGGGTFDVS+LTIE+GIFEVK+TAGDTHLGGEDFDNRMVNHFVQEFKRK K+D
Sbjct: 199 KNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKNKQD 258

Query: 191 LATNKRALRRLRTACERAKRT 253
           +    RALRRLRTACERAKRT
Sbjct: 259 ITGQPRALRRLRTACERAKRT 279



 Score =  142 bits (345), Expect = 2e-34
 Identities = 67/88 (76%), Positives = 76/88 (86%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LSS+ Q +IEIDSL+ G DFY+ ITRARFEE+N DLFR  MEPVEK LRDAKMDK+ 
Sbjct: 277 KRTLSSTAQTTIEIDSLYGGADFYSPITRARFEEMNMDLFRKCMEPVEKCLRDAKMDKST 336

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           +H+IVLVGGSTRIPKVQ+LLQDFFNGKE
Sbjct: 337 VHEIVLVGGSTRIPKVQQLLQDFFNGKE 364



 Score = 70.5 bits (165), Expect = 1e-12
 Identities = 36/68 (52%), Positives = 42/68 (61%)
 Frame = +3

Query: 513 KSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKRNTTI 692
           KSINPDE           IL G+ +E+VQD           G+ETAGGVMTTLI+RNTTI
Sbjct: 367 KSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTTLIQRNTTI 426

Query: 693 PTKQTQTF 716
           PTK+ Q F
Sbjct: 427 PTKKEQVF 434


>At1g09080.1 68414.m01013 luminal binding protein 3 (BiP-3) (BP3)
           Similar to Arabidopsis luminal binding protein
           (gb|D89342); contains Pfam domain PF00012: dnaK protein
          Length = 678

 Score =  126 bits (303), Expect = 2e-29
 Identities = 57/89 (64%), Positives = 74/89 (83%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LS+  Q  +EI+SLF+G+DF   +TRARFEELN DLF+ TMEPV+K+L+DA + K+ 
Sbjct: 316 KRSLSNQHQVRVEIESLFDGVDFSEPLTRARFEELNMDLFKKTMEPVKKALKDAGLKKSD 375

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKEP 510
           I +IVLVGGSTRIPKVQ++L+DFF+GKEP
Sbjct: 376 IDEIVLVGGSTRIPKVQQMLKDFFDGKEP 404



 Score =  120 bits (290), Expect = 7e-28
 Identities = 51/90 (56%), Positives = 73/90 (81%)
 Frame = +2

Query: 2   GTRRNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKY 181
           G   N+L++DLGGGTFDVSILTI++G+FEV ST+GDTHLGGEDFD+R++++F++  K+KY
Sbjct: 235 GGESNILVYDLGGGTFDVSILTIDNGVFEVLSTSGDTHLGGEDFDHRVMDYFIKLVKKKY 294

Query: 182 KKDLATNKRALRRLRTACERAKRTCHRPHK 271
            KD++ + +AL +LR  CE AKR+    H+
Sbjct: 295 NKDISKDHKALGKLRRECELAKRSLSNQHQ 324



 Score = 59.7 bits (138), Expect = 2e-09
 Identities = 30/72 (41%), Positives = 37/72 (51%)
 Frame = +3

Query: 501 KGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKR 680
           K  +K  NPDE           +L G+  EE Q+           GIET GGVMT +I R
Sbjct: 402 KEPSKGTNPDEAVAYGAAVQGGVLSGEGGEETQNILLLDVAPLSLGIETVGGVMTNIIPR 461

Query: 681 NTTIPTKQTQTF 716
           NT IPTK++Q F
Sbjct: 462 NTVIPTKKSQVF 473


>At5g28540.1 68418.m03480 luminal binding protein 1 (BiP-1) (BP1)
           SWISS-PROT:Q9LKR3 PMID:8888624
          Length = 669

 Score =  124 bits (300), Expect = 4e-29
 Identities = 59/89 (66%), Positives = 72/89 (80%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LSS  Q  +EI+SLF+G+DF   +TRARFEELN DLFR TM PV+K++ DA + K+Q
Sbjct: 302 KRALSSQHQVRVEIESLFDGVDFSEPLTRARFEELNNDLFRKTMGPVKKAMDDAGLQKSQ 361

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKEP 510
           I +IVLVGGSTRIPKVQ+LL+DFF GKEP
Sbjct: 362 IDEIVLVGGSTRIPKVQQLLKDFFEGKEP 390



 Score =  122 bits (294), Expect = 2e-28
 Identities = 51/90 (56%), Positives = 73/90 (81%)
 Frame = +2

Query: 2   GTRRNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKY 181
           G  +N+L+FDLGGGTFDVS+LTI++G+FEV ST GDTHLGGEDFD+R++ +F++  K+K+
Sbjct: 221 GGEKNILVFDLGGGTFDVSVLTIDNGVFEVLSTNGDTHLGGEDFDHRVMEYFIKLIKKKH 280

Query: 182 KKDLATNKRALRRLRTACERAKRTCHRPHK 271
           +KD++ + +AL +LR  CERAKR     H+
Sbjct: 281 QKDISKDNKALGKLRRECERAKRALSSQHQ 310



 Score = 63.3 bits (147), Expect = 2e-10
 Identities = 32/72 (44%), Positives = 38/72 (52%)
 Frame = +3

Query: 501 KGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKR 680
           K  NK +NPDE           IL G+  +E +D           GIET GGVMT LI R
Sbjct: 388 KEPNKGVNPDEAVAYGAAVQGGILSGEGGDETKDILLLDVAPLTLGIETVGGVMTKLIPR 447

Query: 681 NTTIPTKQTQTF 716
           NT IPTK++Q F
Sbjct: 448 NTVIPTKKSQVF 459


>At5g42020.2 68418.m05116 luminal binding protein 2 (BiP-2) (BP2)
           similar to SWISS-PROT: Q39043; GI:1303695; luminal
           binding protein (BiP) [Arabidopsis thaliana]
          Length = 613

 Score =  122 bits (294), Expect = 2e-28
 Identities = 51/90 (56%), Positives = 73/90 (81%)
 Frame = +2

Query: 2   GTRRNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKY 181
           G  +N+L+FDLGGGTFDVS+LTI++G+FEV ST GDTHLGGEDFD+R++ +F++  K+K+
Sbjct: 221 GGEKNILVFDLGGGTFDVSVLTIDNGVFEVLSTNGDTHLGGEDFDHRIMEYFIKLIKKKH 280

Query: 182 KKDLATNKRALRRLRTACERAKRTCHRPHK 271
           +KD++ + +AL +LR  CERAKR     H+
Sbjct: 281 QKDISKDNKALGKLRRECERAKRALSSQHQ 310



 Score =  122 bits (294), Expect = 2e-28
 Identities = 58/89 (65%), Positives = 71/89 (79%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LSS  Q  +EI+SLF+G+D    +TRARFEELN DLFR TM PV+K++ DA + K+Q
Sbjct: 302 KRALSSQHQVRVEIESLFDGVDLSEPLTRARFEELNNDLFRKTMGPVKKAMDDAGLQKSQ 361

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKEP 510
           I +IVLVGGSTRIPKVQ+LL+DFF GKEP
Sbjct: 362 IDEIVLVGGSTRIPKVQQLLKDFFEGKEP 390



 Score = 63.3 bits (147), Expect = 2e-10
 Identities = 32/72 (44%), Positives = 38/72 (52%)
 Frame = +3

Query: 501 KGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKR 680
           K  NK +NPDE           IL G+  +E +D           GIET GGVMT LI R
Sbjct: 388 KEPNKGVNPDEAVAYGAAVQGGILSGEGGDETKDILLLDVAPLTLGIETVGGVMTKLIPR 447

Query: 681 NTTIPTKQTQTF 716
           NT IPTK++Q F
Sbjct: 448 NTVIPTKKSQVF 459


>At5g42020.1 68418.m05115 luminal binding protein 2 (BiP-2) (BP2)
           similar to SWISS-PROT: Q39043; GI:1303695; luminal
           binding protein (BiP) [Arabidopsis thaliana]
          Length = 668

 Score =  122 bits (294), Expect = 2e-28
 Identities = 51/90 (56%), Positives = 73/90 (81%)
 Frame = +2

Query: 2   GTRRNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKY 181
           G  +N+L+FDLGGGTFDVS+LTI++G+FEV ST GDTHLGGEDFD+R++ +F++  K+K+
Sbjct: 221 GGEKNILVFDLGGGTFDVSVLTIDNGVFEVLSTNGDTHLGGEDFDHRIMEYFIKLIKKKH 280

Query: 182 KKDLATNKRALRRLRTACERAKRTCHRPHK 271
           +KD++ + +AL +LR  CERAKR     H+
Sbjct: 281 QKDISKDNKALGKLRRECERAKRALSSQHQ 310



 Score =  122 bits (294), Expect = 2e-28
 Identities = 58/89 (65%), Positives = 71/89 (79%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LSS  Q  +EI+SLF+G+D    +TRARFEELN DLFR TM PV+K++ DA + K+Q
Sbjct: 302 KRALSSQHQVRVEIESLFDGVDLSEPLTRARFEELNNDLFRKTMGPVKKAMDDAGLQKSQ 361

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKEP 510
           I +IVLVGGSTRIPKVQ+LL+DFF GKEP
Sbjct: 362 IDEIVLVGGSTRIPKVQQLLKDFFEGKEP 390



 Score = 63.3 bits (147), Expect = 2e-10
 Identities = 32/72 (44%), Positives = 38/72 (52%)
 Frame = +3

Query: 501 KGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKR 680
           K  NK +NPDE           IL G+  +E +D           GIET GGVMT LI R
Sbjct: 388 KEPNKGVNPDEAVAYGAAVQGGILSGEGGDETKDILLLDVAPLTLGIETVGGVMTKLIPR 447

Query: 681 NTTIPTKQTQTF 716
           NT IPTK++Q F
Sbjct: 448 NTVIPTKKSQVF 459


>At4g24280.1 68417.m03486 heat shock protein 70, putative / HSP70,
           putative strong similarity to heat shock protein 70
           [Arabidopsis thaliana] GI:6746592; similar to heat shock
           70 protein - Spinacia oleracea,PID:g2654208
          Length = 718

 Score =  102 bits (244), Expect = 3e-22
 Identities = 46/77 (59%), Positives = 60/77 (77%)
 Frame = +2

Query: 17  VLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLA 196
           +L+FDLGGGTFDVS+L + DG+FEV ST+GDTHLGG+DFD R+V+    EFK+    DL 
Sbjct: 265 ILVFDLGGGTFDVSVLEVGDGVFEVLSTSGDTHLGGDDFDKRVVDWLAAEFKKDEGIDLL 324

Query: 197 TNKRALRRLRTACERAK 247
            +K+AL+RL  A E+AK
Sbjct: 325 KDKQALQRLTEAAEKAK 341



 Score = 76.2 bits (179), Expect = 2e-14
 Identities = 43/95 (45%), Positives = 60/95 (63%), Gaps = 4/95 (4%)
 Frame = +1

Query: 238 EGKEDLSSSTQASIEIDSLFEGID----FYTSITRARFEELNADLFRSTMEPVEKSLRDA 405
           + K +LSS TQ ++ +  +    D      T++TRA+FEEL +DL      PVE SLRDA
Sbjct: 339 KAKIELSSLTQTNMSLPFITATADGPKHIETTLTRAKFEELCSDLLDRVRTPVENSLRDA 398

Query: 406 KMDKAQIHDIVLVGGSTRIPKVQKLLQDFFNGKEP 510
           K+    I +++LVGGSTRIP VQ+L++    GKEP
Sbjct: 399 KLSFKDIDEVILVGGSTRIPAVQELVRK-VTGKEP 432



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 27/72 (37%), Positives = 36/72 (50%)
 Frame = +3

Query: 501 KGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKR 680
           K  N ++NPDE           +L GD    V D           G+ET GGVMT +I R
Sbjct: 430 KEPNVTVNPDEVVALGAAVQAGVLAGD----VSDIVLLDVTPLSIGLETLGGVMTKIIPR 485

Query: 681 NTTIPTKQTQTF 716
           NTT+PT +++ F
Sbjct: 486 NTTLPTSKSEVF 497


>At4g37910.1 68417.m05361 heat shock protein 70, mitochondrial,
           putative / HSP70, mitochondrial, putative strong
           similarity to SP|Q01899 Heat shock 70 kDa protein,
           mitochondrial precursor {Phaseolus vulgaris}
          Length = 682

 Score =  101 bits (242), Expect = 5e-22
 Identities = 47/77 (61%), Positives = 57/77 (74%)
 Frame = +2

Query: 17  VLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLA 196
           + +FDLGGGTFDVSIL I  G+FEVK+T GDT LGGEDFDN ++ + V EFKR    DL 
Sbjct: 238 IAVFDLGGGTFDVSILEISSGVFEVKATNGDTFLGGEDFDNTLLEYLVNEFKRSDNIDLT 297

Query: 197 TNKRALRRLRTACERAK 247
            +  AL+RLR A E+AK
Sbjct: 298 KDNLALQRLREAAEKAK 314



 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 32/95 (33%), Positives = 54/95 (56%), Gaps = 4/95 (4%)
 Frame = +1

Query: 238 EGKEDLSSSTQASIEIDSLFEGID----FYTSITRARFEELNADLFRSTMEPVEKSLRDA 405
           + K +LSS+TQ  I +  +            ++TR++FE L   L   T  P +  L+DA
Sbjct: 312 KAKIELSSTTQTEINLPFITADASGAKHLNITLTRSKFEGLVGKLIERTRSPCQNCLKDA 371

Query: 406 KMDKAQIHDIVLVGGSTRIPKVQKLLQDFFNGKEP 510
            +   ++ +++LVGG TR+PKVQ+++ + F GK P
Sbjct: 372 GVTIKEVDEVLLVGGMTRVPKVQEIVSEIF-GKSP 405



 Score = 52.4 bits (120), Expect = 3e-07
 Identities = 31/72 (43%), Positives = 35/72 (48%)
 Frame = +3

Query: 501 KGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKR 680
           K   K +NPDE           IL GD    V+D           GIET G V T LI R
Sbjct: 403 KSPCKGVNPDEAVAMGAAIQGGILRGD----VKDLLLLDVVPLSLGIETLGAVFTKLIPR 458

Query: 681 NTTIPTKQTQTF 716
           NTTIPTK++Q F
Sbjct: 459 NTTIPTKKSQVF 470


>At5g49910.1 68418.m06180 heat shock protein 70 / HSP70 (HSC70-7)
           identical to heat shock protein 70 [Arabidopsis
           thaliana] GI:6746592
          Length = 718

 Score =  100 bits (240), Expect = 8e-22
 Identities = 45/81 (55%), Positives = 60/81 (74%)
 Frame = +2

Query: 5   TRRNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYK 184
           +   +L+FDLGGGTFDVS+L + DG+FEV ST+GDTHLGG+DFD R+V+     FK+   
Sbjct: 261 SNETILVFDLGGGTFDVSVLEVGDGVFEVLSTSGDTHLGGDDFDKRVVDWLASTFKKDEG 320

Query: 185 KDLATNKRALRRLRTACERAK 247
            DL  +K+AL+RL  A E+AK
Sbjct: 321 IDLLKDKQALQRLTEAAEKAK 341



 Score = 74.1 bits (174), Expect = 8e-14
 Identities = 42/95 (44%), Positives = 58/95 (61%), Gaps = 4/95 (4%)
 Frame = +1

Query: 238 EGKEDLSSSTQASIEIDSLFEGID----FYTSITRARFEELNADLFRSTMEPVEKSLRDA 405
           + K +LSS TQ ++ +  +    D      T++TR +FEEL +DL      PVE SLRDA
Sbjct: 339 KAKIELSSLTQTNMSLPFITATADGPKHIETTLTRGKFEELCSDLLDRVRTPVENSLRDA 398

Query: 406 KMDKAQIHDIVLVGGSTRIPKVQKLLQDFFNGKEP 510
           K+    I +++LVGGSTRIP VQ L++    GKEP
Sbjct: 399 KLSFKDIDEVILVGGSTRIPAVQDLVRK-LTGKEP 432



 Score = 51.6 bits (118), Expect = 5e-07
 Identities = 28/72 (38%), Positives = 36/72 (50%)
 Frame = +3

Query: 501 KGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKR 680
           K  N S+NPDE           +L GD    V D           G+ET GGVMT +I R
Sbjct: 430 KEPNVSVNPDEVVALGAAVQAGVLSGD----VSDIVLLDVTPLSLGLETLGGVMTKIIPR 485

Query: 681 NTTIPTKQTQTF 716
           NTT+PT +++ F
Sbjct: 486 NTTLPTSKSEVF 497


>At5g09590.1 68418.m01110 heat shock protein 70 / HSP70 (HSC70-5)
           identical to heat shock protein 70 [Arabidopsis
           thaliana] GI:6746590
          Length = 682

 Score =   99 bits (238), Expect = 1e-21
 Identities = 46/77 (59%), Positives = 59/77 (76%)
 Frame = +2

Query: 17  VLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLA 196
           + +FDLGGGTFDVS+L I +G+FEVK+T GDT LGGEDFDN +++  V EFK     DLA
Sbjct: 243 IAVFDLGGGTFDVSVLEISNGVFEVKATNGDTFLGGEDFDNALLDFLVNEFKTTEGIDLA 302

Query: 197 TNKRALRRLRTACERAK 247
            ++ AL+RLR A E+AK
Sbjct: 303 KDRLALQRLREAAEKAK 319



 Score = 62.5 bits (145), Expect = 3e-10
 Identities = 33/95 (34%), Positives = 55/95 (57%), Gaps = 4/95 (4%)
 Frame = +1

Query: 238 EGKEDLSSSTQASIEIDSLFEGID----FYTSITRARFEELNADLFRSTMEPVEKSLRDA 405
           + K +LSS++Q  I +  +         F  ++TR+RFE L   L   T +P +  L+DA
Sbjct: 317 KAKIELSSTSQTEINLPFITADASGAKHFNITLTRSRFETLVNHLIERTRDPCKNCLKDA 376

Query: 406 KMDKAQIHDIVLVGGSTRIPKVQKLLQDFFNGKEP 510
            +   ++ +++LVGG TR+PKVQ ++ + F GK P
Sbjct: 377 GISAKEVDEVLLVGGMTRVPKVQSIVAEIF-GKSP 410



 Score = 54.8 bits (126), Expect = 5e-08
 Identities = 31/72 (43%), Positives = 37/72 (51%)
 Frame = +3

Query: 501 KGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKR 680
           K  +K +NPDE           IL GD    V++           GIET GGV T LI R
Sbjct: 408 KSPSKGVNPDEAVAMGAALQGGILRGD----VKELLLLDVTPLSLGIETLGGVFTRLITR 463

Query: 681 NTTIPTKQTQTF 716
           NTTIPTK++Q F
Sbjct: 464 NTTIPTKKSQVF 475


>At1g11660.1 68414.m01339 heat shock protein, putative strong
           similarity to gb|Z70314 heat-shock protein from
           Arabidopsis thaliana and is a member of the PF|00012
           Hsp70 protein family
          Length = 773

 Score = 72.5 bits (170), Expect = 3e-13
 Identities = 33/78 (42%), Positives = 46/78 (58%)
 Frame = +2

Query: 17  VLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLA 196
           ++  D+G     V + + E G   V+S A D +LGG DFD  + NHF  EFK KY  D+ 
Sbjct: 197 IVFIDIGHCDTQVCVASFESGSMRVRSHAFDRNLGGRDFDEVLFNHFALEFKEKYNIDVY 256

Query: 197 TNKRALRRLRTACERAKR 250
           TN +A  RLR +CE+ K+
Sbjct: 257 TNTKACVRLRASCEKVKK 274



 Score = 64.1 bits (149), Expect = 9e-11
 Identities = 31/84 (36%), Positives = 49/84 (58%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K+ LS++ +A + I+ L E  D  + I R  FE+L+A L    + P +K+L D+ +   Q
Sbjct: 273 KKVLSANAEAQLNIECLMEEKDVRSFIKREEFEQLSAGLLERLIVPCQKALADSGLSLDQ 332

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFF 495
           IH + LVG  +RIP + K+L   F
Sbjct: 333 IHSVELVGSGSRIPAISKMLSSLF 356


>At4g16660.1 68417.m02517 heat shock protein 70, putative / HSP70,
           putative
          Length = 867

 Score = 71.7 bits (168), Expect = 4e-13
 Identities = 35/88 (39%), Positives = 59/88 (67%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           KE LS++T A I ++SL +  DF ++ITR +FEEL  DL+  ++ P++  L+ + +    
Sbjct: 309 KEILSANTAAPISVESLHDDRDFRSTITREKFEELCKDLWERSLTPLKDVLKHSGLKIDD 368

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           I  + L+GG+TR+PK+Q  +Q+F  GK+
Sbjct: 369 ISAVELIGGATRVPKLQSTIQEFI-GKQ 395



 Score = 38.7 bits (86), Expect = 0.004
 Identities = 19/63 (30%), Positives = 32/63 (50%), Gaps = 2/63 (3%)
 Frame = +2

Query: 65  TIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLATNK--RALRRLRTACE 238
           T+    F+VK    D  LGG+  + R+V HF  EF ++    +   K  +A+ +L+   +
Sbjct: 247 TVSVNQFQVKDVRWDLGLGGQSMEMRLVEHFADEFNKQLGNGVDVRKFPKAMAKLKKQVK 306

Query: 239 RAK 247
           R K
Sbjct: 307 RTK 309


>At1g79930.1 68414.m09340 heat shock protein, putative contains Pfam
           profile: PF00012 Heat shock hsp70 proteins; similar to
           heat-shock proteins GB:CAA94389, GB:AAD55461
           [Arabidopsis thaliana]
          Length = 831

 Score = 68.1 bits (159), Expect = 5e-12
 Identities = 32/79 (40%), Positives = 45/79 (56%)
 Frame = +2

Query: 14  NVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDL 193
           NV   D+G  +  V I   + G  ++ S A D  LGG DFD  + NHF  +FK +YK D+
Sbjct: 195 NVAFIDIGHASMQVCIAGFKKGQLKILSHAFDRSLGGRDFDEVLFNHFAAKFKDEYKIDV 254

Query: 194 ATNKRALRRLRTACERAKR 250
           + N +A  RLR  CE+ K+
Sbjct: 255 SQNAKASLRLRATCEKLKK 273



 Score = 60.5 bits (140), Expect = 1e-09
 Identities = 30/89 (33%), Positives = 51/89 (57%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K+ LS++  A + I+ L +  D    I R  FEE++  +      P+EK+L DA +    
Sbjct: 272 KKVLSANPLAPLNIECLMDEKDVRGVIKREEFEEISIPILERVKRPLEKALSDAGLTVED 331

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKEP 510
           +H + ++G  +R+P + K+L +FF GKEP
Sbjct: 332 VHMVEVIGSGSRVPAMIKILTEFF-GKEP 359


>At1g79920.2 68414.m09339 heat shock protein 70, putative / HSP70,
           putative contains Pfam profile: PF00012 Heat shock hsp70
           proteins; similar to heat-shock proteins GB:CAA94389,
           GB:AAD55461 [Arabidopsis thaliana]
          Length = 736

 Score = 68.1 bits (159), Expect = 5e-12
 Identities = 32/79 (40%), Positives = 45/79 (56%)
 Frame = +2

Query: 14  NVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDL 193
           NV   D+G  +  V I   + G  ++ S A D  LGG DFD  + NHF  +FK +YK D+
Sbjct: 195 NVAFIDIGHASMQVCIAGFKKGQLKILSHAFDRSLGGRDFDEVLFNHFAAKFKDEYKIDV 254

Query: 194 ATNKRALRRLRTACERAKR 250
           + N +A  RLR  CE+ K+
Sbjct: 255 SQNAKASLRLRATCEKLKK 273



 Score = 60.5 bits (140), Expect = 1e-09
 Identities = 31/89 (34%), Positives = 50/89 (56%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K+ LS++  A + I+ L    D    I R  FEE++  +      P+EK+L DA +    
Sbjct: 272 KKVLSANPMAPLNIECLMAEKDVRGVIKREEFEEISIPILERVKRPLEKALSDAGLTVED 331

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKEP 510
           +H + +VG  +R+P + K+L +FF GKEP
Sbjct: 332 VHMVEVVGSGSRVPAMIKILTEFF-GKEP 359


>At1g79920.1 68414.m09338 heat shock protein 70, putative / HSP70,
           putative contains Pfam profile: PF00012 Heat shock hsp70
           proteins; similar to heat-shock proteins GB:CAA94389,
           GB:AAD55461 [Arabidopsis thaliana]
          Length = 736

 Score = 68.1 bits (159), Expect = 5e-12
 Identities = 32/79 (40%), Positives = 45/79 (56%)
 Frame = +2

Query: 14  NVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDL 193
           NV   D+G  +  V I   + G  ++ S A D  LGG DFD  + NHF  +FK +YK D+
Sbjct: 195 NVAFIDIGHASMQVCIAGFKKGQLKILSHAFDRSLGGRDFDEVLFNHFAAKFKDEYKIDV 254

Query: 194 ATNKRALRRLRTACERAKR 250
           + N +A  RLR  CE+ K+
Sbjct: 255 SQNAKASLRLRATCEKLKK 273



 Score = 60.5 bits (140), Expect = 1e-09
 Identities = 31/89 (34%), Positives = 50/89 (56%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K+ LS++  A + I+ L    D    I R  FEE++  +      P+EK+L DA +    
Sbjct: 272 KKVLSANPMAPLNIECLMAEKDVRGVIKREEFEEISIPILERVKRPLEKALSDAGLTVED 331

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKEP 510
           +H + +VG  +R+P + K+L +FF GKEP
Sbjct: 332 VHMVEVVGSGSRVPAMIKILTEFF-GKEP 359


>At2g32120.2 68415.m03926 heat shock protein 70 family protein /
           HSP70 family protein similar to SP|P22953 Heat shock
           cognate 70 kDa protein 1 (Hsc70.1) {Arabidopsis
           thaliana}; contains InterPro accession IPR001023: Heat
           shock protein Hsp70
          Length = 563

 Score = 50.4 bits (115), Expect = 1e-06
 Identities = 26/79 (32%), Positives = 44/79 (55%)
 Frame = +1

Query: 253 LSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHD 432
           L+      IE+D L  G      + R  FEE+N  +F      V + LRDA+++   I D
Sbjct: 297 LTDQENVQIEVD-LGNGNKISKVLDRLEFEEVNQKVFEECERLVVQCLRDARVNGGDIDD 355

Query: 433 IVLVGGSTRIPKVQKLLQD 489
           +++VGG + IPKV+ ++++
Sbjct: 356 LIMVGGCSYIPKVRTIIKN 374


>At2g32120.1 68415.m03925 heat shock protein 70 family protein /
           HSP70 family protein similar to SP|P22953 Heat shock
           cognate 70 kDa protein 1 (Hsc70.1) {Arabidopsis
           thaliana}; contains InterPro accession IPR001023: Heat
           shock protein Hsp70
          Length = 563

 Score = 50.4 bits (115), Expect = 1e-06
 Identities = 26/79 (32%), Positives = 44/79 (55%)
 Frame = +1

Query: 253 LSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHD 432
           L+      IE+D L  G      + R  FEE+N  +F      V + LRDA+++   I D
Sbjct: 297 LTDQENVQIEVD-LGNGNKISKVLDRLEFEEVNQKVFEECERLVVQCLRDARVNGGDIDD 355

Query: 433 IVLVGGSTRIPKVQKLLQD 489
           +++VGG + IPKV+ ++++
Sbjct: 356 LIMVGGCSYIPKVRTIIKN 374


>At2g44330.1 68415.m05514 zinc finger (C3HC4-type RING finger)
           family protein contains Pfam profile: PF00097 zinc
           finger, C3HC4 type (RING finger)
          Length = 180

 Score = 31.5 bits (68), Expect = 0.58
 Identities = 21/78 (26%), Positives = 40/78 (51%)
 Frame = -3

Query: 473 CTLGIRVEPPTSTISWI*ALSILASRRDFSTGSMVDLNRSAFSSSKRARVIDV*KSIPSK 294
           C +G+RV    S       L  +AS   F++ +  ++  + F   + ++ +D  +S+P+ 
Sbjct: 20  CNIGLRVLSLPSASPPYCPLCNVASY--FTSSTPFEVGPNPFEDDEESQFLDPMESLPTI 77

Query: 293 RESISMLACVDDDRSSLP 240
           + S SML+    D S+LP
Sbjct: 78  KISSSMLSSASSDDSALP 95


>At3g56940.1 68416.m06334 dicarboxylate diiron protein, putative
           (Crd1) similar to leucine-containing zipper protein
           At103 GP:6911864; contains Pfam profile PF05447: Copper
           response defect 1 (CRD1)
          Length = 409

 Score = 29.5 bits (63), Expect = 2.3
 Identities = 14/39 (35%), Positives = 22/39 (56%)
 Frame = -2

Query: 150 LTMRLSKSSPPKWVSPAVDFTSKIPSSMVRMDTSKVPPP 34
           L   +SK S PK  +P+   + +  S+++RM  S  PPP
Sbjct: 7   LVKPISKFSSPKLSNPSKFLSGRRFSTVIRMSASSSPPP 45


>At1g44446.3 68414.m05115 chlorophyll a oxygenase (CAO) /
           chlorophyll b synthase identical to chlorophyll a
           oxygenase GI:5853117 from [Arabidopsis thaliana];
           contains Pfam PF00355 Rieske [2Fe-2S] domain
          Length = 433

 Score = 29.5 bits (63), Expect = 2.3
 Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 5/54 (9%)
 Frame = -1

Query: 286 LSQCSLVWTMTG--PLCPLTCSTQTPKSSLVGSEVLFVFPLE---LLDKVVDHA 140
           L Q  ++W   G  P  P+  S Q P   L+ +E++   P+E   LLD ++D A
Sbjct: 313 LEQEGMIWIWPGDEPPAPILPSLQPPSGFLIHAELVMDLPVEHGLLLDNLLDLA 366


>At1g44446.2 68414.m05114 chlorophyll a oxygenase (CAO) /
           chlorophyll b synthase identical to chlorophyll a
           oxygenase GI:5853117 from [Arabidopsis thaliana];
           contains Pfam PF00355 Rieske [2Fe-2S] domain
          Length = 511

 Score = 29.5 bits (63), Expect = 2.3
 Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 5/54 (9%)
 Frame = -1

Query: 286 LSQCSLVWTMTG--PLCPLTCSTQTPKSSLVGSEVLFVFPLE---LLDKVVDHA 140
           L Q  ++W   G  P  P+  S Q P   L+ +E++   P+E   LLD ++D A
Sbjct: 313 LEQEGMIWIWPGDEPPAPILPSLQPPSGFLIHAELVMDLPVEHGLLLDNLLDLA 366


>At1g44446.1 68414.m05113 chlorophyll a oxygenase (CAO) /
           chlorophyll b synthase identical to chlorophyll a
           oxygenase GI:5853117 from [Arabidopsis thaliana];
           contains Pfam PF00355 Rieske [2Fe-2S] domain
          Length = 536

 Score = 29.5 bits (63), Expect = 2.3
 Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 5/54 (9%)
 Frame = -1

Query: 286 LSQCSLVWTMTG--PLCPLTCSTQTPKSSLVGSEVLFVFPLE---LLDKVVDHA 140
           L Q  ++W   G  P  P+  S Q P   L+ +E++   P+E   LLD ++D A
Sbjct: 313 LEQEGMIWIWPGDEPPAPILPSLQPPSGFLIHAELVMDLPVEHGLLLDNLLDLA 366


>At3g09000.1 68416.m01053 proline-rich family protein
          Length = 541

 Score = 29.1 bits (62), Expect = 3.1
 Identities = 19/46 (41%), Positives = 25/46 (54%)
 Frame = +3

Query: 66  PSRMVSSR*NPPPATPTWEVRTLTIAWSTTLSRSSRGNTKRTSLPT 203
           PS   SSR    PATPT   R+ T   ST+   ++R +  R+S PT
Sbjct: 147 PSSSGSSRSTSRPATPT--RRSTTPTTSTSRPVTTRASNSRSSTPT 190


>At3g07760.2 68416.m00944 expressed protein
          Length = 125

 Score = 29.1 bits (62), Expect = 3.1
 Identities = 16/62 (25%), Positives = 28/62 (45%)
 Frame = +2

Query: 80  IFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLATNKRALRRLRTACERAKRTCH 259
           IF+     G+       F    + HF++    K+  D  T  + LRR++ AC + ++   
Sbjct: 35  IFKENGVNGEYLESMSVFTTEQILHFIRRHHMKWG-DFITLCKELRRIKVACLKGEQRVR 93

Query: 260 RP 265
           RP
Sbjct: 94  RP 95


>At3g07760.1 68416.m00943 expressed protein
          Length = 125

 Score = 29.1 bits (62), Expect = 3.1
 Identities = 16/62 (25%), Positives = 28/62 (45%)
 Frame = +2

Query: 80  IFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLATNKRALRRLRTACERAKRTCH 259
           IF+     G+       F    + HF++    K+  D  T  + LRR++ AC + ++   
Sbjct: 35  IFKENGVNGEYLESMSVFTTEQILHFIRRHHMKWG-DFITLCKELRRIKVACLKGEQRVR 93

Query: 260 RP 265
           RP
Sbjct: 94  RP 95


>At4g26820.1 68417.m03862 hypothetical protein 
          Length = 242

 Score = 28.7 bits (61), Expect = 4.1
 Identities = 16/50 (32%), Positives = 26/50 (52%)
 Frame = -1

Query: 157 KVVDHAIVKVLTSQVGVAGGGFHLEDTILDGKDGHVEGTAAEVKDKYISS 8
           KV+D      +  +V V GG   L D +  G+ G   GT+A   ++Y+S+
Sbjct: 154 KVIDEEAAWEMEDEVAVTGGVVGL-DMVFSGRVGFYPGTSALWGEQYMSA 202


>At1g19190.1 68414.m02389 expressed protein contains similarity to
           anther-specific and pathogenesis response protein
           (PrMC3) GI:5487873 from [Pinus radiata]
          Length = 318

 Score = 28.7 bits (61), Expect = 4.1
 Identities = 18/63 (28%), Positives = 31/63 (49%), Gaps = 13/63 (20%)
 Frame = -2

Query: 168 NSWT--KWLTMRLSKSSPPKWVSPAVDFT----------SKIPSSM-VRMDTSKVPPPRS 28
           +SW   +W+   +++S P  W++   DF+          + I   M +R+D  K+PP   
Sbjct: 127 DSWDAIQWIFTHITRSGPEDWLNKHADFSKVFLAGDSAGANIAHHMAIRVDKEKLPPENF 186

Query: 27  KIS 19
           KIS
Sbjct: 187 KIS 189


>At1g03080.1 68414.m00282 kinase interacting family protein similar to
            kinase interacting protein 1 (GI:13936326) [Petunia
            integrifolia]
          Length = 1744

 Score = 28.7 bits (61), Expect = 4.1
 Identities = 17/50 (34%), Positives = 27/50 (54%)
 Frame = -3

Query: 707  SLFSGDGSVTLDECGHDTSSSLNTEGKGCYIKQQQILHLLRLVTVQDSSL 558
            ++  GD + TLDE  + T S+L  E + C  K +  + LL   T+  S+L
Sbjct: 1082 TILQGDNNKTLDEKAYLTKSTLQLEEEKC--KLEDDISLLLSETIYQSNL 1129


>At1g73430.1 68414.m08500 sec34-like family protein contains Pfam
           PF04136: Sec34-like family profile; similar to Conserved
           oligomeric Golgi complex component 3 (Vesicle docking
           protein SEC34 homolog) (p94) (Swiss-Prot:Q96JB2) [Homo
           sapiens]
          Length = 784

 Score = 28.3 bits (60), Expect = 5.4
 Identities = 17/53 (32%), Positives = 33/53 (62%), Gaps = 2/53 (3%)
 Frame = +1

Query: 244 KEDLSSSTQASIEID--SLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSL 396
           ++++++ T +  ++D  +  EG    TS T  R +E NAD+F++   P+EK+L
Sbjct: 464 RDEIANYTPSDEDLDYPAKLEGSPNTTSETDLRDDE-NADVFKTWYPPLEKTL 515


>At1g69570.1 68414.m08001 Dof-type zinc finger domain-containing
           protein nearly identical to H-protein promoter binding
           factor-2b (Arabidopsis thaliana) GI:3386548
          Length = 399

 Score = 28.3 bits (60), Expect = 5.4
 Identities = 15/38 (39%), Positives = 20/38 (52%)
 Frame = -1

Query: 487 LAGASAPWGYEWSHPPVQYRGFEPYPSWHHGETSPLAP 374
           L   S+PW Y+WS P      F P P ++ G T P+ P
Sbjct: 255 LPNNSSPWPYQWS-PTGPNASFYPVP-FYWGCTVPIYP 290


>At3g54280.1 68416.m05999 SNF2 domain-containing protein / helicase
           domain-containing protein similar to SP|O14981
           TBP-associated factor 172 (TAF-172) (TAF(II)170) {Homo
           sapiens}; contains PFam profiles PF00271: Helicase
           conserved C-terminal domain, PF00176: SNF2 family
           N-terminal domain
          Length = 2049

 Score = 27.9 bits (59), Expect = 7.1
 Identities = 18/57 (31%), Positives = 29/57 (50%), Gaps = 2/57 (3%)
 Frame = +1

Query: 286 DSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDIVL--VGG 450
           D+ FE  D    +TR R  +LN  +  + +EP+ K  +     K+ I + VL  +GG
Sbjct: 346 DNGFELKDVLNKVTREREIDLNMQVSENELEPLRKRPKIEDPSKSFIDNTVLEVIGG 402


>At1g06850.1 68414.m00730 bZIP transcription factor, putative
           contains Pfam profile: PF00170 bZIP transcription factor
          Length = 337

 Score = 27.9 bits (59), Expect = 7.1
 Identities = 15/27 (55%), Positives = 15/27 (55%)
 Frame = +3

Query: 24  SLTSAAVPSTCPSLPSRMVSSR*NPPP 104
           SLTS   P   PSL S  VS   NPPP
Sbjct: 78  SLTSNPNPFQNPSLSSNSVSGAANPPP 104


>At2g42820.1 68415.m05301 abscisic acid-responsive HVA22 family
           protein contains Pfam profile PF03134: TB2/DP1, HVA22
           family
          Length = 158

 Score = 27.5 bits (58), Expect = 9.4
 Identities = 12/29 (41%), Positives = 15/29 (51%)
 Frame = +2

Query: 377 SQWRSLSVMPRWIRLKSTILYWWVAPLVS 463
           S WR L+ +P W  LK     W V P+ S
Sbjct: 59  SVWRVLAWLPFWPYLKLLFCMWLVLPMFS 87


>At2g19910.1 68415.m02327 RNA-dependent RNA polymerase family protein
            contains Pfam domain, PF05183: RNA dependent RNA
            polymerase
          Length = 992

 Score = 27.5 bits (58), Expect = 9.4
 Identities = 12/41 (29%), Positives = 20/41 (48%), Gaps = 1/41 (2%)
 Frame = -1

Query: 304  YPQRENLSQCSLVWTMTGP-LCPLTCSTQTPKSSLVGSEVL 185
            Y  +E +++C+  W + GP LC         KS +  + VL
Sbjct: 947  YAIQEGVAKCTFAWNVAGPVLCKFYLKKTKDKSVVASTSVL 987


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,432,065
Number of Sequences: 28952
Number of extensions: 358684
Number of successful extensions: 1223
Number of sequences better than 10.0: 38
Number of HSP's better than 10.0 without gapping: 1133
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1218
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1555552968
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -