SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B03
         (549 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g57860.1 68414.m06565 60S ribosomal protein L21 similar to 60...   150   7e-37
At1g57660.1 68414.m06543 60S ribosomal protein L21 (RPL21E) simi...   150   7e-37
At1g09690.1 68414.m01088 60S ribosomal protein L21 (RPL21C) Simi...   149   1e-36
At1g09590.1 68414.m01076 60S ribosomal protein L21 (RPL21A) Simi...   149   1e-36
At4g26610.1 68417.m03835 protein kinase, putative similar to pro...    31   0.51 
At2g43030.1 68415.m05340 ribosomal protein L3 family protein con...    30   0.89 
At1g68130.1 68414.m07782 zinc finger (C2H2 type) family protein ...    30   1.2  
At5g25320.1 68418.m03004 ACT domain-containing protein contains ...    29   1.5  
At4g02670.1 68417.m00362 zinc finger (C2H2 type) family protein ...    29   1.5  
At3g45260.1 68416.m04887 zinc finger (C2H2 type) family protein ...    29   2.0  
At5g66730.1 68418.m08412 zinc finger (C2H2 type) family protein ...    29   2.7  
At3g50700.1 68416.m05547 zinc finger (C2H2 type) family protein ...    29   2.7  
At3g32030.1 68416.m04070 terpene synthase/cyclase family protein...    29   2.7  
At2g02080.1 68415.m00144 zinc finger (C2H2 type) family protein ...    29   2.7  
At2g02070.1 68415.m00143 zinc finger (C2H2 type) family protein ...    29   2.7  
At1g14580.1 68414.m01734 zinc finger (C2H2 type) family protein ...    29   2.7  
At2g43900.1 68415.m05457 endonuclease/exonuclease/phosphatase fa...    28   3.6  
At2g13150.1 68415.m01450 expressed protein contains a bZIP trans...    28   3.6  
At5g53450.2 68418.m06643 protein kinase family protein contains ...    28   4.7  
At5g53450.1 68418.m06642 protein kinase family protein contains ...    28   4.7  
At1g20020.1 68414.m02507 ferredoxin--NADP(+) reductase, putative...    28   4.7  
At5g05890.1 68418.m00649 UDP-glucoronosyl/UDP-glucosyl transfera...    27   6.2  
At4g31490.1 68417.m04473 coatomer beta subunit, putative / beta-...    27   6.2  
At3g45880.1 68416.m04965 hypothetical protein                          27   6.2  
At1g62330.1 68414.m07033 expressed protein contains Pfam PF03138...    27   6.2  
At5g44160.1 68418.m05404 zinc finger (C2H2 type) family protein ...    27   8.3  
At5g41240.1 68418.m05011 glutathione S-transferase, putative sim...    27   8.3  
At5g05900.1 68418.m00651 UDP-glucoronosyl/UDP-glucosyl transfera...    27   8.3  
At5g03150.1 68418.m00263 zinc finger (C2H2 type) family protein ...    27   8.3  
At4g31670.1 68417.m04497 ubiquitin carboxyl-terminal hydrolase f...    27   8.3  
At1g76990.3 68414.m08966 ACT domain containing protein low simil...    27   8.3  
At1g76990.2 68414.m08965 ACT domain containing protein low simil...    27   8.3  
At1g76990.1 68414.m08964 ACT domain containing protein low simil...    27   8.3  
At1g03840.1 68414.m00365 zinc finger (C2H2 type) family protein ...    27   8.3  

>At1g57860.1 68414.m06565 60S ribosomal protein L21 similar to 60S
           ribosomal protein L21 GI:3885884 from [Oryza sativa]
          Length = 164

 Score =  150 bits (363), Expect = 7e-37
 Identities = 67/129 (51%), Positives = 94/129 (72%)
 Frame = +2

Query: 125 YMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVNKRVRGRIIPKRI 304
           Y++ +KVGD VD++ NGA+ KGMPHK YHG+TGR++NVT  A+GV VNK++  RII KRI
Sbjct: 30  YLRTFKVGDYVDVKVNGAIHKGMPHKFYHGRTGRIWNVTKRAVGVEVNKQIGNRIIRKRI 89

Query: 305 NIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKAAHIVSGTEKPVL 484
           ++RVEHV+ S+C ++F  R K+N+ L  +AKA G+T++ KRQP  PK   +V G      
Sbjct: 90  HVRVEHVQQSRCAEEFKLRKKQNDVLKADAKARGETISTKRQPKGPKPGFMVEGMTLET- 148

Query: 485 LAPIPYEFV 511
           + PIPY+ V
Sbjct: 149 VTPIPYDVV 157


>At1g57660.1 68414.m06543 60S ribosomal protein L21 (RPL21E) similar
           to 60S ribosomal protein L21 GB:Q43291 GI:2851508 from
           [Arabidopsis thaliana]
          Length = 164

 Score =  150 bits (363), Expect = 7e-37
 Identities = 67/129 (51%), Positives = 94/129 (72%)
 Frame = +2

Query: 125 YMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVNKRVRGRIIPKRI 304
           Y++ +KVGD VD++ NGA+ KGMPHK YHG+TGR++NVT  A+GV VNK++  RII KRI
Sbjct: 30  YLRTFKVGDYVDVKVNGAIHKGMPHKFYHGRTGRIWNVTKRAVGVEVNKQIGNRIIRKRI 89

Query: 305 NIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKAAHIVSGTEKPVL 484
           ++RVEHV+ S+C ++F  R K+N+ L  +AKA G+T++ KRQP  PK   +V G      
Sbjct: 90  HVRVEHVQQSRCAEEFKLRKKQNDVLKADAKARGETISTKRQPKGPKPGFMVEGMTLET- 148

Query: 485 LAPIPYEFV 511
           + PIPY+ V
Sbjct: 149 VTPIPYDVV 157


>At1g09690.1 68414.m01088 60S ribosomal protein L21 (RPL21C) Similar
           to ribosomal protein L21 (gb|L38826). ESTs
           gb|AA395597,gb|ATTS5197 come from this gene
          Length = 164

 Score =  149 bits (361), Expect = 1e-36
 Identities = 67/129 (51%), Positives = 93/129 (72%)
 Frame = +2

Query: 125 YMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVNKRVRGRIIPKRI 304
           Y++ +KVGD VD++ NGA+ KGMPHK YHG+TGR++NVT  A+GV VNK++  RII KRI
Sbjct: 30  YLRTFKVGDYVDVKVNGAIHKGMPHKFYHGRTGRIWNVTKRAVGVEVNKQIGNRIIRKRI 89

Query: 305 NIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKAAHIVSGTEKPVL 484
           ++RVEHV+ S+C ++F  R K+N+ L   AKA G+T++ KRQP  PK   +V G      
Sbjct: 90  HVRVEHVQQSRCAEEFKLRKKKNDELKAAAKANGETISTKRQPKGPKPGFMVEGMTLET- 148

Query: 485 LAPIPYEFV 511
           + PIPY+ V
Sbjct: 149 VTPIPYDVV 157


>At1g09590.1 68414.m01076 60S ribosomal protein L21 (RPL21A) Similar
           to L21 family of ribosomal protein; amino acid sequence
           is identical to F21M12.8
          Length = 164

 Score =  149 bits (361), Expect = 1e-36
 Identities = 67/129 (51%), Positives = 93/129 (72%)
 Frame = +2

Query: 125 YMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVNKRVRGRIIPKRI 304
           Y++ +KVGD VD++ NGA+ KGMPHK YHG+TGR++NVT  A+GV VNK++  RII KRI
Sbjct: 30  YLRTFKVGDYVDVKVNGAIHKGMPHKFYHGRTGRIWNVTKRAVGVEVNKQIGNRIIRKRI 89

Query: 305 NIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKAAHIVSGTEKPVL 484
           ++RVEHV+ S+C ++F  R K+N+ L   AKA G+T++ KRQP  PK   +V G      
Sbjct: 90  HVRVEHVQQSRCAEEFKLRKKKNDELKAAAKANGETISTKRQPKGPKPGFMVEGMTLET- 148

Query: 485 LAPIPYEFV 511
           + PIPY+ V
Sbjct: 149 VTPIPYDVV 157


>At4g26610.1 68417.m03835 protein kinase, putative similar to
           protein kinase G11A [Oryza sativa] SWISS-PROT:P47997
          Length = 506

 Score = 31.1 bits (67), Expect = 0.51
 Identities = 16/39 (41%), Positives = 21/39 (53%), Gaps = 3/39 (7%)
 Frame = -1

Query: 171 LPLMSTMSPTLY---TFMXRGERNSSMCAEPASEQVPWC 64
           L L  T+SPT+         G++NS  CA+PA  Q P C
Sbjct: 269 LSLRCTVSPTVVRSTVLASEGQKNSGYCAQPACIQQPSC 307


>At2g43030.1 68415.m05340 ribosomal protein L3 family protein
           contains Pfam profile PF00297: ribosomal protein L3
          Length = 271

 Score = 30.3 bits (65), Expect = 0.89
 Identities = 34/130 (26%), Positives = 58/130 (44%), Gaps = 5/130 (3%)
 Frame = +2

Query: 53  LPPRHQGTCSLAGSAHMELFRSPRYMKVYKVGDIVDIRGNGAVQKGMPH--KVYHGKTGR 226
           +P RH     L      E  +   + +++K GD+VD+ G   + KG     K +H K G+
Sbjct: 129 IPMRHLQEFRLTNIEGFEPNQKLVFDEIFKEGDLVDVAGT-TIGKGFQGGIKRHHFKRGQ 187

Query: 227 V-YNVTAH-ALGVIVNKRVRGRIIP-KRINIRVEHVKHSKCRQDFLKRVKENERLLKEAK 397
           + +   +H ALG I      GR+   K++  R+   +    +   +K  KE   ++ +  
Sbjct: 188 MTHGSKSHRALGSIGAGTTPGRVYKGKKMPGRMGGTRTKIRKLKIVKVDKELNVVMIKGA 247

Query: 398 AAGKTVNLKR 427
             GK  NL R
Sbjct: 248 LPGKPGNLLR 257


>At1g68130.1 68414.m07782 zinc finger (C2H2 type) family protein
           contains Pfam domain, PF00096: Zinc finger, C2H2 type
          Length = 419

 Score = 29.9 bits (64), Expect = 1.2
 Identities = 25/84 (29%), Positives = 35/84 (41%), Gaps = 4/84 (4%)
 Frame = +1

Query: 148 RHCRHQRQWCS--SKGYATQSIPWKDRSRVQRDCSCS--RCDCQQACSRKDYTEAHQYPC 315
           +H  H++  C   SKGYA QS    D     + C      CDC +  SR +    HQ  C
Sbjct: 141 KHSNHKQWICERCSKGYAVQS----DYKAHLKTCGTRGHSCDCGRVFSRVESFIEHQDTC 196

Query: 316 *ACQALQVQTRLP*ESQRE*EATE 387
              ++     RL  + Q    AT+
Sbjct: 197 TVRRSQPSNHRLHEQQQHTTNATQ 220


>At5g25320.1 68418.m03004 ACT domain-containing protein contains
           Pfam ACT domain PF01842
          Length = 500

 Score = 29.5 bits (63), Expect = 1.5
 Identities = 16/48 (33%), Positives = 23/48 (47%), Gaps = 4/48 (8%)
 Frame = +1

Query: 175 CSSKGYATQSIPWKDRSRVQRDCSCSRCDCQ----QACSRKDYTEAHQ 306
           C  +GY+  ++  KDR R+  D  C+  D Q     A  R D  +A Q
Sbjct: 291 CEERGYSIVTVKSKDRRRLMFDTICTLVDMQYVIFHAALRSDGADAFQ 338


>At4g02670.1 68417.m00362 zinc finger (C2H2 type) family protein
           similar to potato PCP1 zinc finger protein, GenBank
           accession number X82328 contains Pfam domain, PF00096:
           Zinc finger, C2H2 type
          Length = 402

 Score = 29.5 bits (63), Expect = 1.5
 Identities = 22/56 (39%), Positives = 29/56 (51%), Gaps = 5/56 (8%)
 Frame = +1

Query: 163 QRQW-CS--SKGYATQSIPWKDRSRV--QRDCSCSRCDCQQACSRKDYTEAHQYPC 315
           +++W C   SK YA QS  WK  +++   RD    RCDC    SRKD    H+  C
Sbjct: 156 EKKWKCEKCSKFYAVQS-DWKAHTKICGTRDY---RCDCGTLFSRKDTFITHRAFC 207


>At3g45260.1 68416.m04887 zinc finger (C2H2 type) family protein
           contains Pfam domain, PF00096: Zinc finger, C2H2 type
          Length = 446

 Score = 29.1 bits (62), Expect = 2.0
 Identities = 21/56 (37%), Positives = 27/56 (48%), Gaps = 5/56 (8%)
 Frame = +1

Query: 163 QRQW-CS--SKGYATQSIPWKDRSRVQRDCSCS--RCDCQQACSRKDYTEAHQYPC 315
           +++W C   SK YA  S  WK  S++   C     RCDC    SRKD    H+  C
Sbjct: 142 EKKWKCDKCSKKYAVMS-DWKAHSKI---CGTKEYRCDCGTLFSRKDSFITHRAFC 193


>At5g66730.1 68418.m08412 zinc finger (C2H2 type) family protein
           contains Pfam domain, PF00096: Zinc finger, C2H2 type
          Length = 500

 Score = 28.7 bits (61), Expect = 2.7
 Identities = 20/56 (35%), Positives = 28/56 (50%), Gaps = 5/56 (8%)
 Frame = +1

Query: 163 QRQW-CS--SKGYATQSIPWKDRSRVQRDCSCS--RCDCQQACSRKDYTEAHQYPC 315
           +++W C   SK YA QS  WK  S++   C     +CDC    SR+D    H+  C
Sbjct: 134 EKKWKCEKCSKKYAVQS-DWKAHSKI---CGTKEYKCDCGTLFSRRDSFITHRAFC 185


>At3g50700.1 68416.m05547 zinc finger (C2H2 type) family protein
           contains Pfam domain, PF00096: Zinc finger, C2H2 type
          Length = 452

 Score = 28.7 bits (61), Expect = 2.7
 Identities = 20/56 (35%), Positives = 28/56 (50%), Gaps = 5/56 (8%)
 Frame = +1

Query: 163 QRQW-CS--SKGYATQSIPWKDRSRVQRDCSCS--RCDCQQACSRKDYTEAHQYPC 315
           +++W C   SK YA QS  WK  S++   C     +CDC    SR+D    H+  C
Sbjct: 136 EKKWKCDKCSKKYAVQS-DWKAHSKI---CGTKEYKCDCGTLFSRRDSFITHRAFC 187


>At3g32030.1 68416.m04070 terpene synthase/cyclase family protein
           contains Pfam profile: PF01397 terpene synthase family
          Length = 604

 Score = 28.7 bits (61), Expect = 2.7
 Identities = 16/46 (34%), Positives = 22/46 (47%)
 Frame = -3

Query: 367 FDSLKEVLSALGVLDMLNTDIDALRYNPSANTLVDNHTESMSSHVV 230
           FDS  ++L AL VL  +N DI       S   +V+     M+ H V
Sbjct: 482 FDSKPKILQALSVLYRINNDIVTYEREMSKGEVVNGVNSYMNQHGV 527


>At2g02080.1 68415.m00144 zinc finger (C2H2 type) family protein
           contains Pfam domain PF00096: Zinc finger, C2H2 type
          Length = 516

 Score = 28.7 bits (61), Expect = 2.7
 Identities = 21/56 (37%), Positives = 27/56 (48%), Gaps = 5/56 (8%)
 Frame = +1

Query: 163 QRQW-CS--SKGYATQSIPWKDRSRVQRDCSCS--RCDCQQACSRKDYTEAHQYPC 315
           +++W C   SK YA QS  WK  S+    C     RCDC    SR+D    H+  C
Sbjct: 156 EKKWKCEKCSKRYAVQS-DWKAHSKT---CGTKEYRCDCGTIFSRRDSYITHRAFC 207


>At2g02070.1 68415.m00143 zinc finger (C2H2 type) family protein
           contains Pfam domain, PF00096: Zinc finger, C2H2 type
          Length = 602

 Score = 28.7 bits (61), Expect = 2.7
 Identities = 21/56 (37%), Positives = 27/56 (48%), Gaps = 5/56 (8%)
 Frame = +1

Query: 163 QRQW-CS--SKGYATQSIPWKDRSRVQRDCSCS--RCDCQQACSRKDYTEAHQYPC 315
           +++W C   SK YA QS  WK  S+    C     RCDC    SR+D    H+  C
Sbjct: 154 EKKWKCDKCSKRYAVQS-DWKAHSKT---CGTKEYRCDCGTLFSRRDSFITHRAFC 205


>At1g14580.1 68414.m01734 zinc finger (C2H2 type) family protein
           similar to zinc finger protein ID1 GB:AAC18941
           GI:3170601 from [Zea mays]  contains Pfam domain,
           PF00096: Zinc finger, C2H2 type
          Length = 467

 Score = 28.7 bits (61), Expect = 2.7
 Identities = 21/56 (37%), Positives = 27/56 (48%), Gaps = 5/56 (8%)
 Frame = +1

Query: 163 QRQW-CS--SKGYATQSIPWKDRSRVQRDCSCS--RCDCQQACSRKDYTEAHQYPC 315
           +++W C   SK YA QS  WK  S+    C     RCDC    SR+D    H+  C
Sbjct: 155 EKKWKCDKCSKRYAVQS-DWKAHSKT---CGTKEYRCDCGTIFSRRDSYITHRAFC 206


>At2g43900.1 68415.m05457 endonuclease/exonuclease/phosphatase family
            protein belongs to Pfam:PF03372:
            Endonuclease/Exonuclease/phosphatase family; contains 3
            WD-40 repeats (PF00400);similar to Type II
            inositol-1,4,5-trisphosphate 5-phosphatase EC 3.1.3.56
            (5PTASE) (INPP5B) (SP:P32019) [Homo sapiens]
          Length = 1305

 Score = 28.3 bits (60), Expect = 3.6
 Identities = 10/28 (35%), Positives = 20/28 (71%)
 Frame = +2

Query: 299  RINIRVEHVKHSKCRQDFLKRVKENERL 382
            + ++++EHV  S  RQ+F + +K NE++
Sbjct: 920  KFHVKIEHVDRSVRRQEFGRIIKTNEKV 947


>At2g13150.1 68415.m01450 expressed protein contains a bZIP
           transcription factor basic domain signature (PDOC00036)
          Length = 262

 Score = 28.3 bits (60), Expect = 3.6
 Identities = 19/55 (34%), Positives = 29/55 (52%)
 Frame = +3

Query: 318 SMSSTPSADKTSLRESKRMRGY*RKPRLPARPST*RDSQLPLKLPTSSVELRNPS 482
           S +STPS  ++  + S         P L   PS+ R + +PL  P++SVE R+ S
Sbjct: 4   SDNSTPSRPRSITQPSLAFSSL---PPLSPSPSSSRRNSIPLMNPSASVESRDSS 55


>At5g53450.2 68418.m06643 protein kinase family protein contains
           protein kinase domain, Pfam:PF00069
          Length = 590

 Score = 27.9 bits (59), Expect = 4.7
 Identities = 20/76 (26%), Positives = 32/76 (42%)
 Frame = +2

Query: 50  GLPPRHQGTCSLAGSAHMELFRSPRYMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRV 229
           GL  R   T +L G+ H+ + R+   +    +    DIR      K  PH    G  G++
Sbjct: 396 GLTLRQPSTRALIGNVHLTITRASESINNTSLSFTSDIRFTAITSKDWPHNKI-GAAGKL 454

Query: 230 YNVTAHALGVIVNKRV 277
             ++   L  I  KR+
Sbjct: 455 QTLSQFRL--IAGKRL 468


>At5g53450.1 68418.m06642 protein kinase family protein contains
           protein kinase domain, Pfam:PF00069
          Length = 670

 Score = 27.9 bits (59), Expect = 4.7
 Identities = 20/76 (26%), Positives = 32/76 (42%)
 Frame = +2

Query: 50  GLPPRHQGTCSLAGSAHMELFRSPRYMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRV 229
           GL  R   T +L G+ H+ + R+   +    +    DIR      K  PH    G  G++
Sbjct: 476 GLTLRQPSTRALIGNVHLTITRASESINNTSLSFTSDIRFTAITSKDWPHNKI-GAAGKL 534

Query: 230 YNVTAHALGVIVNKRV 277
             ++   L  I  KR+
Sbjct: 535 QTLSQFRL--IAGKRL 548


>At1g20020.1 68414.m02507 ferredoxin--NADP(+) reductase, putative /
           adrenodoxin reductase, putative strong similarity to
           Ferredoxin--NADP reductase, chloroplast precursor (EC
           1.18.1.2) (FNR) from {Pisum sativum} SP|P10933,
           {Mesembryanthemum crystallinum} SP|P41343, {Spinacia
           oleracea} SP|P00455, [Capsicum annuum] GI:6899972
          Length = 369

 Score = 27.9 bits (59), Expect = 4.7
 Identities = 15/44 (34%), Positives = 24/44 (54%)
 Frame = +2

Query: 137 YKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVN 268
           Y+ G  V +  +G  + G PHKV      R+Y++ + ALG + N
Sbjct: 125 YREGQSVGVIADGIDKNGKPHKV------RLYSIASSALGDLGN 162


>At5g05890.1 68418.m00649 UDP-glucoronosyl/UDP-glucosyl transferase
           family protein contains Pfam profile: PF00201
           UDP-glucoronosyl and UDP-glucosyl transferase
          Length = 455

 Score = 27.5 bits (58), Expect = 6.2
 Identities = 18/72 (25%), Positives = 28/72 (38%)
 Frame = -3

Query: 364 DSLKEVLSALGVLDMLNTDIDALRYNPSANTLVDNHTESMSSHVVHATCLSMVYFVWHTL 185
           + + E L+  G +       D L++      L  N   S    V  A  +  + F W  +
Sbjct: 320 EEIMEKLNEKGKIVKWAPQQDVLKHRAIGGFLTHNGWSSTVESVCEAVPMICLPFRWDQM 379

Query: 184 LNCTIASDVYNV 149
           LN    SDV+ V
Sbjct: 380 LNARFVSDVWMV 391


>At4g31490.1 68417.m04473 coatomer beta subunit, putative /
           beta-coat protein, putative / beta-COP, putative similar
           to Coatomer beta subunit (Beta-coat protein) (Beta-COP)
           from {Rattus norvegicus} SP|P23514, {Mus musculus}
           SP|Q9JIF7, {Homo sapiens} SP|P53618; contains Pfam
           profile: PF01602 Adaptin N terminal region
          Length = 948

 Score = 27.5 bits (58), Expect = 6.2
 Identities = 12/39 (30%), Positives = 23/39 (58%), Gaps = 1/39 (2%)
 Frame = +2

Query: 305 NIRVEHVKHSKCRQDFLKRVKENE-RLLKEAKAAGKTVN 418
           N+ ++ +    CRQ F+K + E + R ++E KA  +T +
Sbjct: 628 NVEMKKIWLESCRQSFVKMISEKQLREMEELKAKTQTTH 666


>At3g45880.1 68416.m04965 hypothetical protein
          Length = 431

 Score = 27.5 bits (58), Expect = 6.2
 Identities = 18/55 (32%), Positives = 24/55 (43%)
 Frame = -3

Query: 433 WLSLQVDGLAGSLGFLQ*PLILFDSLKEVLSALGVLDMLNTDIDALRYNPSANTL 269
           W  +Q D       FLQ  L    SL  VLS     D  ++D +  ++ PSA  L
Sbjct: 299 WYDMQFDIKYAYFNFLQSLLYKSSSLNPVLSWREDEDSESSDAEGSKFTPSATNL 353


>At1g62330.1 68414.m07033 expressed protein contains Pfam PF03138:
           Plant protein family. The function of this family of
           plant proteins is unknown;
          Length = 672

 Score = 27.5 bits (58), Expect = 6.2
 Identities = 13/28 (46%), Positives = 15/28 (53%)
 Frame = +2

Query: 188 GMPHKVYHGKTGRVYNVTAHALGVIVNK 271
           G P K Y+G  GR+    AHAL    NK
Sbjct: 182 GKPKKTYNGTYGRLLAYAAHALAEGQNK 209


>At5g44160.1 68418.m05404 zinc finger (C2H2 type) family protein
           contains Pfam domain, PF00096: Zinc finger, C2H2 type
          Length = 466

 Score = 27.1 bits (57), Expect = 8.3
 Identities = 20/56 (35%), Positives = 27/56 (48%), Gaps = 5/56 (8%)
 Frame = +1

Query: 163 QRQW-CS--SKGYATQSIPWKDRSRVQRDCSCS--RCDCQQACSRKDYTEAHQYPC 315
           +++W C   +K YA QS  WK  S+    C     RCDC    SR+D    H+  C
Sbjct: 139 EKKWTCEKCAKRYAVQS-DWKAHSKT---CGTREYRCDCGTIFSRRDSFITHRAFC 190


>At5g41240.1 68418.m05011 glutathione S-transferase, putative
           similar to glutathione S-transferase, GST 10b
           GB:CAA10662 [Arabidopsis thaliana] 37349.
          Length = 591

 Score = 27.1 bits (57), Expect = 8.3
 Identities = 7/14 (50%), Positives = 11/14 (78%)
 Frame = +1

Query: 142 SWRHCRHQRQWCSS 183
           +WR  RH ++WCS+
Sbjct: 385 AWRELRHNKKWCST 398


>At5g05900.1 68418.m00651 UDP-glucoronosyl/UDP-glucosyl transferase
           family protein contains Pfam profile: PF00201
           UDP-glucoronosyl and UDP-glucosyl transferase
          Length = 450

 Score = 27.1 bits (57), Expect = 8.3
 Identities = 15/52 (28%), Positives = 21/52 (40%)
 Frame = -3

Query: 304 DALRYNPSANTLVDNHTESMSSHVVHATCLSMVYFVWHTLLNCTIASDVYNV 149
           + L++      L  N   S    V     +  + FVW  LLN    SDV+ V
Sbjct: 335 EVLKHQAIGGFLTHNGWNSTVESVFEGVPMICMPFVWDQLLNARFVSDVWMV 386


>At5g03150.1 68418.m00263 zinc finger (C2H2 type) family protein
           contains Pfam domain, PF00096: Zinc finger, C2H2 type
          Length = 503

 Score = 27.1 bits (57), Expect = 8.3
 Identities = 20/56 (35%), Positives = 27/56 (48%), Gaps = 5/56 (8%)
 Frame = +1

Query: 163 QRQW-CS--SKGYATQSIPWKDRSRVQRDCSCS--RCDCQQACSRKDYTEAHQYPC 315
           +++W C   SK YA QS  WK  ++    C     +CDC    SRKD    H+  C
Sbjct: 156 EKKWKCEKCSKKYAVQS-DWKAHAKT---CGTREYKCDCGTLFSRKDSFITHRAFC 207


>At4g31670.1 68417.m04497 ubiquitin carboxyl-terminal hydrolase
           family protein / zinc finger (MYND type) family protein
           similar to ubiquitin-specific protease 15 (UBP15)
           [Arabidopsis thaliana] GI:11993475; contains Pfam
           profiles PF00443: Ubiquitin carboxyl-terminal hydrolase,
           PF01753: MYND finger
          Length = 631

 Score = 27.1 bits (57), Expect = 8.3
 Identities = 11/27 (40%), Positives = 13/27 (48%), Gaps = 4/27 (14%)
 Frame = +1

Query: 247 CSRCD----CQQACSRKDYTEAHQYPC 315
           CSRC     C   C R D++  HQ  C
Sbjct: 72  CSRCKSVRYCSAECQRSDWSSGHQRNC 98


>At1g76990.3 68414.m08966 ACT domain containing protein low
           similarity to uridylyltransferase SP|P56884 from
           Rhizobium meliloti; contains Pfam ACT domain PF01842
          Length = 453

 Score = 27.1 bits (57), Expect = 8.3
 Identities = 10/31 (32%), Positives = 17/31 (54%)
 Frame = +1

Query: 175 CSSKGYATQSIPWKDRSRVQRDCSCSRCDCQ 267
           C  KGY+  ++  +DR ++  D  C+  D Q
Sbjct: 259 CEEKGYSVINVSCEDRPKLMFDIVCTLTDMQ 289


>At1g76990.2 68414.m08965 ACT domain containing protein low
           similarity to uridylyltransferase SP|P56884 from
           Rhizobium meliloti; contains Pfam ACT domain PF01842
          Length = 453

 Score = 27.1 bits (57), Expect = 8.3
 Identities = 10/31 (32%), Positives = 17/31 (54%)
 Frame = +1

Query: 175 CSSKGYATQSIPWKDRSRVQRDCSCSRCDCQ 267
           C  KGY+  ++  +DR ++  D  C+  D Q
Sbjct: 259 CEEKGYSVINVSCEDRPKLMFDIVCTLTDMQ 289


>At1g76990.1 68414.m08964 ACT domain containing protein low
           similarity to uridylyltransferase SP|P56884 from
           Rhizobium meliloti; contains Pfam ACT domain PF01842
          Length = 453

 Score = 27.1 bits (57), Expect = 8.3
 Identities = 10/31 (32%), Positives = 17/31 (54%)
 Frame = +1

Query: 175 CSSKGYATQSIPWKDRSRVQRDCSCSRCDCQ 267
           C  KGY+  ++  +DR ++  D  C+  D Q
Sbjct: 259 CEEKGYSVINVSCEDRPKLMFDIVCTLTDMQ 289


>At1g03840.1 68414.m00365 zinc finger (C2H2 type) family protein
           contains Zinc finger,C2H2 type,domain contains Pfam
           domain, PF00096: Zinc finger, C2H2 type
          Length = 506

 Score = 27.1 bits (57), Expect = 8.3
 Identities = 20/56 (35%), Positives = 27/56 (48%), Gaps = 5/56 (8%)
 Frame = +1

Query: 163 QRQW-CS--SKGYATQSIPWKDRSRVQRDCSCS--RCDCQQACSRKDYTEAHQYPC 315
           +++W C   +K YA QS  WK  S+    C     RCDC    SR+D    H+  C
Sbjct: 143 EKKWKCEKCAKRYAVQS-DWKAHSKT---CGTREYRCDCGTIFSRRDSFITHRAFC 194


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,730,086
Number of Sequences: 28952
Number of extensions: 239235
Number of successful extensions: 789
Number of sequences better than 10.0: 34
Number of HSP's better than 10.0 without gapping: 767
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 789
length of database: 12,070,560
effective HSP length: 77
effective length of database: 9,841,256
effective search space used: 1033331880
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -