Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P01_F_A06
         (324 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At4g16340.1 68417.m02476 adapter protein SPIKE1 (SPK1) One model...    27   2.2  

>At4g16340.1 68417.m02476 adapter protein SPIKE1 (SPK1) One model
            reflects the alignment of a full-length cDNA sequence
            gi:18496702.  There are multiple frame shifts in the gene
            model resulting in a truncated protein.  The alternate
            model includes modifications in exons 14, 17 and 29 to
            compensate for frame shifts and maximize the protein
            length.  It is not based on EST data.  adapter protein
            SPIKE1 [Arabidopsis thaliana] GI:18496703
          Length = 1757

 Score = 27.5 bits (58), Expect = 2.2
 Identities = 16/54 (29%), Positives = 25/54 (46%)
 Frame = -2

Query: 167  RNSFLWNIDHVTAHCTICLLKTTMFQYQGSDAYNCTHYSKRYYAIDSVTRVLDV 6
            RN  +W+ DHV+A   IC + +  F  + S A     Y      +DS  + L +
Sbjct: 1385 RNDGVWSKDHVSALRKICPMVSGEFTTEAS-AAEVEGYGASKLTVDSAVKYLQL 1437


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 4,205,056
Number of Sequences: 28952
Number of extensions: 64583
Number of successful extensions: 171
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 159
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 171
length of database: 12,070,560
effective HSP length: 71
effective length of database: 10,014,968
effective search space used: 360538848
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)