SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= e40h0022
         (702 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At3g45780.1 68416.m04953 protein kinase / nonphototropic hypocot...    30   1.7  

>At3g45780.1 68416.m04953 protein kinase / nonphototropic hypocotyl
           protein 1 (NPH1) / phototropin identical to SP|O48963
           Nonphototropic hypocotyl protein 1 (EC 2.7.1.37)
           (Phototropin) {Arabidopsis thaliana}, cDNA
           nonphototropic hypocotyl 1 (NPH1) GI:2832240; contains
           Pfam profiles PF00069:Protein kinase domain and
           PF00785:PAC motif
          Length = 996

 Score = 29.9 bits (64), Expect = 1.7
 Identities = 22/71 (30%), Positives = 31/71 (43%), Gaps = 5/71 (7%)
 Frame = +3

Query: 225 PVSYVASGVFNVVNYTSTQDV*LTYNFTYVSRTDDNTI-----ILLLWPNTLSRSTRFKK 389
           P+ Y ++G FN+  YTS + V     F   S TD + +      L    N   R   +KK
Sbjct: 210 PIMYASAGFFNMTGYTSKEVVGRNCRFLQGSGTDADELAKIRETLAAGNNYCGRILNYKK 269

Query: 390 NLLEFTLRLTI 422
           +   F   LTI
Sbjct: 270 DGTSFWNLLTI 280


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,759,028
Number of Sequences: 28952
Number of extensions: 197713
Number of successful extensions: 245
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 244
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 245
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1506636208
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -