SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120012.Seq
         (701 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At3g32940.1 68416.m04174 expressed protein                             30   1.3  
At1g15530.1 68414.m01868 receptor lectin kinase, putative simila...    30   1.3  
At3g52160.1 68416.m05726 beta-ketoacyl-CoA synthase family prote...    29   3.9  
At3g26540.1 68416.m03313 pentatricopeptide (PPR) repeat-containi...    29   3.9  
At5g18510.1 68418.m02185 hypothetical protein                          27   9.1  
At4g24520.1 68417.m03515 NADPH-cytochrome p450 reductase, putati...    27   9.1  

>At3g32940.1 68416.m04174 expressed protein
          Length = 607

 Score = 30.3 bits (65), Expect = 1.3
 Identities = 20/65 (30%), Positives = 32/65 (49%), Gaps = 7/65 (10%)
 Frame = +2

Query: 179 RRCKQTRG*KIQIYVQRVGGETTALAP---NSVAKQGDPLYLQPHTVLITK----SGVIQ 337
           +R ++  G K+QI+  + GGE   L+P   N + K    LY Q  +    K      V++
Sbjct: 162 KRLEKETGAKVQIFGTKTGGEKVELSPSDENEIQKSWQELYFQISSDTYEKVDAAIAVVE 221

Query: 338 LIMKS 352
           L+M S
Sbjct: 222 LLMSS 226


>At1g15530.1 68414.m01868 receptor lectin kinase, putative similar
           to receptor lectin kinase 3 [Arabidopsis thaliana]
           gi|4100060|gb|AAD00733; contains pfam domains PF00139:
           Legume lectins beta domain and PF00069: Protein kinase
           domain
          Length = 656

 Score = 30.3 bits (65), Expect = 1.3
 Identities = 18/66 (27%), Positives = 31/66 (46%)
 Frame = +1

Query: 400 NSSSAMHGQVRPRN*TTGGKEQTVGDYXXCDIYRAHNALQGWWRKKPRNFLKSKSLSNAS 579
           N S A  G +RPR  T   ++  + +Y   D+Y   +A +  W +  R    S S + A 
Sbjct: 219 NVSVAPVGVLRPRRPTLTFRDPVIANYVSADMYAGFSASKTNWNEARRILAWSLSDTGAL 278

Query: 580 SQLRTS 597
            ++ T+
Sbjct: 279 REINTT 284


>At3g52160.1 68416.m05726 beta-ketoacyl-CoA synthase family protein
           beta-ketoacyl-CoA synthase - Simmondsia
           chinensis,PID:g1045614
          Length = 451

 Score = 28.7 bits (61), Expect = 3.9
 Identities = 21/51 (41%), Positives = 27/51 (52%), Gaps = 2/51 (3%)
 Frame = +2

Query: 251 LAPNSVAKQGDPLYLQPHTVLITKSGVIQLIMKSK--LPYAIELQEWLLEE 397
           L P+SV       Y  P  + ITKS  I+L MKS      AIELQ  +L++
Sbjct: 83  LTPSSVFLLDFSCYRPPDHLKITKSDFIELAMKSGNFNETAIELQRKVLDQ 133


>At3g26540.1 68416.m03313 pentatricopeptide (PPR) repeat-containing
           protein contains Pfam profile: PF01535 PPR repeat
          Length = 700

 Score = 28.7 bits (61), Expect = 3.9
 Identities = 13/25 (52%), Positives = 17/25 (68%)
 Frame = -2

Query: 505 VLGKCRNXXSHQLFVLFLLLFNCGV 431
           + G CRN  S ++F LF+LL N GV
Sbjct: 569 IRGCCRNGRSKEVFELFMLLENEGV 593


>At5g18510.1 68418.m02185 hypothetical protein
          Length = 702

 Score = 27.5 bits (58), Expect = 9.1
 Identities = 11/34 (32%), Positives = 21/34 (61%)
 Frame = +2

Query: 371 ELQEWLLEEVIPQVLCTGKYDPAIKQQEEKNKQL 472
           E   WLLE+   +  C GK+   +K++E+ +++L
Sbjct: 625 EADSWLLEDREIERRCIGKFCSEVKKEEDVDERL 658


>At4g24520.1 68417.m03515 NADPH-cytochrome p450 reductase, putative
           / NADPH-ferrihemoprotein reductase, putative similar to
           NADPH-ferrihemoprotein reductase NADPH-cytochrome P450
           oxydoreductase isoform 1 [Populus balsamifera subsp.
           trichocarpa x Populus deltoides] GI:13183562, SP|P37116
           NADPH-cytochrome P450 reductase (EC 1.6.2.4) (CPR)
           [Vigna radiata] {Phaseolus aureus}
          Length = 692

 Score = 27.5 bits (58), Expect = 9.1
 Identities = 13/30 (43%), Positives = 17/30 (56%)
 Frame = -1

Query: 200 HVSAYSVFTISIF*TAGDVLGHKLDLRVSL 111
           HV  Y+   + I   AG +LGH LDL  S+
Sbjct: 331 HVGVYAENHVEIVEEAGKLLGHSLDLVFSI 360


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,598,327
Number of Sequences: 28952
Number of extensions: 291217
Number of successful extensions: 752
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 733
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 752
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1506636208
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -