BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40092 (808 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC19B12.03 |bgs3||1,3-beta-glucan synthase subunit Bgs3|Schizo... 27 4.1 SPBC8D2.05c |sfi1||spindle pole body protein Sfi1|Schizosaccharo... 26 7.2 SPAC4A8.08c |vas1||mitochondrial valine-tRNA ligase Vas1|Schizos... 26 7.2 SPCPB1C11.03 |||cysteine transporter |Schizosaccharomyces pombe|... 26 7.2 SPAC17A2.10c |||sequence orphan|Schizosaccharomyces pombe|chr 1|... 25 9.6 SPBP35G2.10 |mit1||SHREC complex subunit Mit1|Schizosaccharomyce... 25 9.6 >SPAC19B12.03 |bgs3||1,3-beta-glucan synthase subunit Bgs3|Schizosaccharomyces pombe|chr 1|||Manual Length = 1826 Score = 26.6 bits (56), Expect = 4.1 Identities = 15/45 (33%), Positives = 25/45 (55%) Frame = +2 Query: 53 FPSFSESRTAIHFYIYRLMQCYFIAWQIFILSVTYYFLILDMPSV 187 + SF ESRT +HF + + W I +SV +YF + + P++ Sbjct: 408 YKSFRESRTWLHF-----LHNFSRIW-ILHISVFWYFTVYNSPTI 446 >SPBC8D2.05c |sfi1||spindle pole body protein Sfi1|Schizosaccharomyces pombe|chr 2|||Manual Length = 840 Score = 25.8 bits (54), Expect = 7.2 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = +2 Query: 80 AIHFYIYRLMQCYFIAWQIFILSVTYYFLILD 175 A FY RLM+ + W+ + ++ +YF I D Sbjct: 681 ADQFYNERLMRSAMVFWRYQLRAIKFYFNISD 712 >SPAC4A8.08c |vas1||mitochondrial valine-tRNA ligase Vas1|Schizosaccharomyces pombe|chr 1|||Manual Length = 950 Score = 25.8 bits (54), Expect = 7.2 Identities = 15/60 (25%), Positives = 30/60 (50%), Gaps = 1/60 (1%) Frame = +2 Query: 26 PKLAKSVQPFPSFSESRTAIHFYIYRL-MQCYFIAWQIFILSVTYYFLILDMPSVCVSKS 202 PK +K +QP P + + F+I R+ + C + + ++ + + L+ D +SKS Sbjct: 502 PK-SKDIQPLPFIESGQDILFFWIARMALLCKYFSNELPFKEIILHPLVRDSEGRKMSKS 560 >SPCPB1C11.03 |||cysteine transporter |Schizosaccharomyces pombe|chr 3|||Manual Length = 570 Score = 25.8 bits (54), Expect = 7.2 Identities = 16/49 (32%), Positives = 22/49 (44%), Gaps = 1/49 (2%) Frame = +2 Query: 35 AKSVQPFPSFSESRTAIHFYIYRLMQCYFIAWQIFILSVTY-YFLILDM 178 AK + P ES+ YIY L+ F+ +FI T Y IL + Sbjct: 80 AKKLDPLTPKQESKLKWKLYIYLLLMLGFLDMMLFIGKATLSYSTILGL 128 >SPAC17A2.10c |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 230 Score = 25.4 bits (53), Expect = 9.6 Identities = 12/42 (28%), Positives = 22/42 (52%) Frame = +2 Query: 47 QPFPSFSESRTAIHFYIYRLMQCYFIAWQIFILSVTYYFLIL 172 +PFP+F T ++R + +F + +F LS ++ F L Sbjct: 96 RPFPNFLHPFTGSELSLFRCLLLFFF-FLLFFLSFSFSFSFL 136 >SPBP35G2.10 |mit1||SHREC complex subunit Mit1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1418 Score = 25.4 bits (53), Expect = 9.6 Identities = 13/38 (34%), Positives = 24/38 (63%) Frame = +1 Query: 226 SLNIKNSNRSYEIGNRSLVEIAKQFNISKSVLHRHVTR 339 S +I++ N YE+ RSL E + +F I + ++ + +TR Sbjct: 849 SPDIEDRNLPYELAMRSLEEASCKFLILRLLVPKLITR 886 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,179,827 Number of Sequences: 5004 Number of extensions: 63484 Number of successful extensions: 147 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 142 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 147 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 392429240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -