BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40091 (492 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC19C7.04c |||conserved fungal protein|Schizosaccharomyces pom... 28 0.66 SPAC25B8.04c |||mitochondrial splicing suppressor |Schizosacchar... 26 2.7 SPAC57A10.02 |cdr2||GIN4 family protein kinase Cdr2|Schizosaccha... 25 8.2 >SPBC19C7.04c |||conserved fungal protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 124 Score = 28.3 bits (60), Expect = 0.66 Identities = 11/37 (29%), Positives = 24/37 (64%) Frame = -1 Query: 462 KLLKT*NKIQTESVLYRQYFGTN*NAPLQNHPTYFRH 352 ++ +T ++ T S+L + Y+G + P +N+PT +R+ Sbjct: 20 EMAQTNKEVPTTSLLSKDYYGHSIEEPDENNPTRWRY 56 >SPAC25B8.04c |||mitochondrial splicing suppressor |Schizosaccharomyces pombe|chr 1|||Manual Length = 378 Score = 26.2 bits (55), Expect = 2.7 Identities = 9/17 (52%), Positives = 14/17 (82%) Frame = -3 Query: 364 LFSASWVPSLWSLISLR 314 L+S+SW+P+L L+S R Sbjct: 285 LYSSSWIPTLHDLVSTR 301 >SPAC57A10.02 |cdr2||GIN4 family protein kinase Cdr2|Schizosaccharomyces pombe|chr 1|||Manual Length = 775 Score = 24.6 bits (51), Expect = 8.2 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = -3 Query: 307 PVCAMGTFLSPLTASGTFS 251 P + FL+P+T SGTF+ Sbjct: 384 PATSASPFLTPVTTSGTFN 402 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,750,968 Number of Sequences: 5004 Number of extensions: 31647 Number of successful extensions: 75 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 73 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 75 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 192109570 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -