BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30750 (728 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z74034-3|CAF31476.1| 322|Caenorhabditis elegans Hypothetical pr... 29 3.4 Z81565-4|CAB04582.3| 511|Caenorhabditis elegans Hypothetical pr... 28 7.9 >Z74034-3|CAF31476.1| 322|Caenorhabditis elegans Hypothetical protein F43A11.6 protein. Length = 322 Score = 29.1 bits (62), Expect = 3.4 Identities = 17/40 (42%), Positives = 24/40 (60%), Gaps = 1/40 (2%) Frame = +3 Query: 174 GNFRSVSN-AIIYLFLFTFNAQFLNNLLIVFS*LGNIIPL 290 G F SV N +I+Y+F++ + NL+ VF LGN I L Sbjct: 30 GIFGSVCNLSIVYIFMYVPKEKTSFNLICVFRSLGNTIIL 69 >Z81565-4|CAB04582.3| 511|Caenorhabditis elegans Hypothetical protein K06G5.2 protein. Length = 511 Score = 27.9 bits (59), Expect = 7.9 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = -2 Query: 328 EICLKSKLLVEWCKGMIFPNYENTISKLFKN 236 +I L+ + W ++FP +ENTI F N Sbjct: 208 KIFLRKNRVYPWYLAVMFPGFENTIKNTFFN 238 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,839,156 Number of Sequences: 27780 Number of extensions: 288202 Number of successful extensions: 718 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 688 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 718 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1718929214 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -