BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30742 (701 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_06_0280 + 22010270-22011407,22011890-22013097 32 0.51 09_03_0177 - 13120816-13120941,13121032-13121137,13121231-131213... 31 1.2 12_02_0674 - 21745321-21746223,21746229-21747608 29 2.7 11_04_0306 + 16176873-16177124,16178155-16179152,16179204-161793... 29 2.7 02_03_0134 - 15596379-15597689 29 3.6 03_02_0243 - 6744164-6744415,6744518-6745135 29 4.7 09_02_0194 - 5641920-5642867,5642895-5642983,5643049-5643280 28 6.2 03_06_0354 - 33333634-33333840,33334106-33334213,33335384-333355... 28 6.2 10_06_0029 + 9822216-9823124,9825210-9825329,9826188-9826304,982... 28 8.3 06_03_1404 - 29928792-29929040,29929147-29929551,29930130-299302... 28 8.3 >09_06_0280 + 22010270-22011407,22011890-22013097 Length = 781 Score = 31.9 bits (69), Expect = 0.51 Identities = 15/41 (36%), Positives = 23/41 (56%) Frame = +1 Query: 463 QEALHFVGLKISDVKATKWSHSLTISTSMPSTLSTSVKKNS 585 QE LH V K S WSH+++ TS+ ST S+++ + Sbjct: 733 QEVLHSVSTKKSKELHVSWSHAISEGTSLDSTRQYSLEEEN 773 >09_03_0177 - 13120816-13120941,13121032-13121137,13121231-13121305, 13121385-13121461,13122462-13122549,13122638-13122699, 13122807-13122863,13122960-13123049,13123186-13123251, 13123530-13123619,13123711-13123804,13123915-13124213 Length = 409 Score = 30.7 bits (66), Expect = 1.2 Identities = 17/60 (28%), Positives = 29/60 (48%) Frame = +1 Query: 391 AFYQLYKRIVQYVIEFKQYQVPYTQEALHFVGLKISDVKATKWSHSLTISTSMPSTLSTS 570 A+ K ++ EF+ ++ P+ EA+H V L+I + A K L S P L ++ Sbjct: 91 AYSSFEKAANAFLQEFRNWETPWAMEAMHTVALEIR-LLAEKADRELATSGKNPDKLQSA 149 >12_02_0674 - 21745321-21746223,21746229-21747608 Length = 760 Score = 29.5 bits (63), Expect = 2.7 Identities = 28/85 (32%), Positives = 38/85 (44%), Gaps = 5/85 (5%) Frame = +3 Query: 3 LFELATSRL-STPFIIHLPK---EAMTTSCT-PRRTTKKFASSTFMRRHSSNTSSKVTSR 167 L +TS++ STP L + +T+CT P T SST S ++SK +S Sbjct: 548 LLSSSTSKIPSTPSTCELSTATGKIPSTTCTSPLSTATGKTSSTPSTSPLSTSTSKTSST 607 Query: 168 PSTKKLICTVAKQSTLWATTGRRTP 242 PST L + K T T TP Sbjct: 608 PSTSPLSSSTIKIPTTARTGELSTP 632 >11_04_0306 + 16176873-16177124,16178155-16179152,16179204-16179339, 16179448-16179597,16179711-16179891,16181139-16181298, 16182156-16182378 Length = 699 Score = 29.5 bits (63), Expect = 2.7 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = +3 Query: 132 HSSNTSSKVTSRPSTKKLICTVAKQSTLWATTGRRTPIY 248 H TS+ + PSTK L+C+ +Q+ L + R P+Y Sbjct: 583 HLDTTSTSINLHPSTKLLLCS-QEQAGLKFSLSRACPLY 620 >02_03_0134 - 15596379-15597689 Length = 436 Score = 29.1 bits (62), Expect = 3.6 Identities = 20/57 (35%), Positives = 29/57 (50%), Gaps = 4/57 (7%) Frame = +3 Query: 72 TSCTPRRTTKKFASSTFMRRHSSNTS----SKVTSRPSTKKLICTVAKQSTLWATTG 230 +S P T + SS M R + ++S S ++SRP K+ + AKQ T AT G Sbjct: 113 SSVWPPALTARNRSSKDMNRTAKSSSAMQKSNLSSRPGVDKMAASSAKQRTQKATPG 169 >03_02_0243 - 6744164-6744415,6744518-6745135 Length = 289 Score = 28.7 bits (61), Expect = 4.7 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = -1 Query: 689 DDGVSGNIRFNIDCHSERLVV 627 D VSG+ RF++ C ERLVV Sbjct: 87 DVRVSGSARFDVQCRGERLVV 107 >09_02_0194 - 5641920-5642867,5642895-5642983,5643049-5643280 Length = 422 Score = 28.3 bits (60), Expect = 6.2 Identities = 20/62 (32%), Positives = 27/62 (43%) Frame = +3 Query: 87 RRTTKKFASSTFMRRHSSNTSSKVTSRPSTKKLICTVAKQSTLWATTGRRTPIYSKRLPP 266 R K +RR SS S + R +L T AK TLW +G R + R PP Sbjct: 16 RALLAKLTPLHLLRRGSSALSCFMLPRAILAELYVTGAKSLTLWLWSGIRI-LVPCRAPP 74 Query: 267 IL 272 ++ Sbjct: 75 LM 76 >03_06_0354 - 33333634-33333840,33334106-33334213,33335384-33335557, 33335637-33335765,33335858-33336145,33336257-33336489, 33336607-33337435 Length = 655 Score = 28.3 bits (60), Expect = 6.2 Identities = 14/45 (31%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = -1 Query: 644 SERLVV-KTWLTDLVTVRRVLEFFFTEVDSVEGIEVEMVKECDHF 513 +ER+ V KTW++ V+ FF ++S + + E+ KE + F Sbjct: 423 AERMAVRKTWMSAAQKSSNVVARFFVALNSRKEVNAELKKEAEFF 467 >10_06_0029 + 9822216-9823124,9825210-9825329,9826188-9826304, 9826387-9826476,9826706-9826756 Length = 428 Score = 27.9 bits (59), Expect = 8.3 Identities = 23/68 (33%), Positives = 28/68 (41%), Gaps = 1/68 (1%) Frame = +3 Query: 36 PFIIHLPKEAMTTSCTPRR-TTKKFASSTFMRRHSSNTSSKVTSRPSTKKLICTVAKQST 212 P H P A TPRR T ASS R SS++SS S ++ T A +T Sbjct: 20 PAAAHAPNSAAAACSTPRRGKTSPHASS---RHASSSSSSSSLPSCSAARVAVTPAPHAT 76 Query: 213 LWATTGRR 236 A R Sbjct: 77 ATAPVTMR 84 >06_03_1404 - 29928792-29929040,29929147-29929551,29930130-29930280, 29930363-29930501,29930578-29930743,29930826-29931041, 29931142-29931323,29931412-29931538,29931974-29932112, 29932227-29932353,29932501-29932612,29932704-29932784, 29933330-29933483,29933569-29933689,29934003-29934045, 29934356-29934460 Length = 838 Score = 27.9 bits (59), Expect = 8.3 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = +2 Query: 56 QRSNDYELHTEKNYEEIRFLDIYEKTFFQYLQQGHFKAF 172 ++S E T+KNYE I F D ++ QYL K F Sbjct: 607 EKSPFLERLTKKNYEVIYFTDPVDEYLMQYLMDYEDKKF 645 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,876,672 Number of Sequences: 37544 Number of extensions: 358357 Number of successful extensions: 1013 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 983 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1013 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1803843684 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -