BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS31040 (430 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 23 6.1 AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 23 6.1 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 22.6 bits (46), Expect = 6.1 Identities = 11/31 (35%), Positives = 13/31 (41%) Frame = -2 Query: 285 CERLLTFLQARLASASVMIPRQTTFSNVTRF 193 C T LQAR ASV T + R+ Sbjct: 364 CMVYTTLLQARATVASVFAQHDTELERIKRY 394 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 22.6 bits (46), Expect = 6.1 Identities = 12/40 (30%), Positives = 19/40 (47%) Frame = -2 Query: 141 ILVVAALGRLVAIALSV*RPKRQVISQQLHY*RRIFVRIF 22 ++ + L L V P+R ++ L+Y RIF IF Sbjct: 1311 VITMILLSSLALALEDVHLPQRPILQDILYYMDRIFTVIF 1350 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 347,800 Number of Sequences: 2352 Number of extensions: 5441 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 35292513 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -