BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30999 (458 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF099920-10|AAO91710.1| 1051|Caenorhabditis elegans Transbilayer... 36 0.019 AF099920-9|AAK29849.1| 1222|Caenorhabditis elegans Transbilayer ... 36 0.019 >AF099920-10|AAO91710.1| 1051|Caenorhabditis elegans Transbilayer amphipath transporters(subfamily iv p-type atpase) protein 2, isoform b protein. Length = 1051 Score = 35.5 bits (78), Expect = 0.019 Identities = 14/45 (31%), Positives = 22/45 (48%) Frame = -2 Query: 247 FFYLSIDYAFLNHLYPFLCAYLSACPIDALMRKCYPIYYMELLTL 113 FFY + + N Y F C Y + DA++ CY +++ L L Sbjct: 653 FFYKNFAFTLTNFWYSFFCGYSAQTVFDAVLIACYNLFFTALPVL 697 >AF099920-9|AAK29849.1| 1222|Caenorhabditis elegans Transbilayer amphipath transporters(subfamily iv p-type atpase) protein 2, isoform a protein. Length = 1222 Score = 35.5 bits (78), Expect = 0.019 Identities = 14/45 (31%), Positives = 22/45 (48%) Frame = -2 Query: 247 FFYLSIDYAFLNHLYPFLCAYLSACPIDALMRKCYPIYYMELLTL 113 FFY + + N Y F C Y + DA++ CY +++ L L Sbjct: 824 FFYKNFAFTLTNFWYSFFCGYSAQTVFDAVLIACYNLFFTALPVL 868 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,616,874 Number of Sequences: 27780 Number of extensions: 84286 Number of successful extensions: 273 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 233 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 273 length of database: 12,740,198 effective HSP length: 75 effective length of database: 10,656,698 effective search space used: 820565746 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -