BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30982 (711 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ314781-1|ABC54566.1| 407|Anopheles gambiae OSKAR protein. 23 9.5 AY324307-1|AAQ89692.1| 154|Anopheles gambiae insulin-like pepti... 23 9.5 >DQ314781-1|ABC54566.1| 407|Anopheles gambiae OSKAR protein. Length = 407 Score = 23.0 bits (47), Expect = 9.5 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = -2 Query: 296 FQH*PNH*SYSLKPYSLLNKIIKKHVL 216 FQ P S S+ P+ L NK+ ++H+L Sbjct: 361 FQPGPRKVSGSIMPHVLWNKLGRQHML 387 >AY324307-1|AAQ89692.1| 154|Anopheles gambiae insulin-like peptide 1 precursor protein. Length = 154 Score = 23.0 bits (47), Expect = 9.5 Identities = 9/33 (27%), Positives = 16/33 (48%) Frame = -2 Query: 230 KKHVLHRRIQRYISLSVRMVRC*LSLSRTVCLD 132 ++H HRR++R + C L ++ C D Sbjct: 122 EEHNFHRRVRRQVVAECCYQSCTLDTLKSYCAD 154 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 604,935 Number of Sequences: 2352 Number of extensions: 10188 Number of successful extensions: 53 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 52 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 53 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 72758970 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -