BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20921 (608 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein pr... 22 4.6 AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory recept... 21 6.1 AM292322-1|CAL23134.1| 373|Tribolium castaneum gustatory recept... 21 6.1 AY490815-1|AAR82970.1| 136|Tribolium castaneum glass protein pr... 21 8.1 >AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein protein. Length = 392 Score = 21.8 bits (44), Expect = 4.6 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = -1 Query: 332 NTKPTLPLMCGNSFSRAGLL 273 N KP + +CG S++R L Sbjct: 246 NQKPNVCRICGKSYARPSTL 265 Score = 21.0 bits (42), Expect = 8.1 Identities = 12/32 (37%), Positives = 14/32 (43%) Frame = +3 Query: 225 SWEKTL*CAKHQRPPGQQSSPRETVATHQGQR 320 S EK C R Q SS + TH G+R Sbjct: 301 SGEKPFRCPVCDRRFSQSSSVTTHMRTHSGER 332 >AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory receptor candidate 41 protein. Length = 398 Score = 21.4 bits (43), Expect = 6.1 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +2 Query: 98 NYFVKIIQLLDEYPKCF 148 N KI L+DE+ +CF Sbjct: 214 NLHNKICNLIDEFNECF 230 >AM292322-1|CAL23134.1| 373|Tribolium castaneum gustatory receptor candidate 1 protein. Length = 373 Score = 21.4 bits (43), Expect = 6.1 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +2 Query: 5 SRAFCLVLKFHRSPYATLSR 64 S FCLV HR Y LS+ Sbjct: 20 SEIFCLVNFNHRESYFRLSK 39 >AY490815-1|AAR82970.1| 136|Tribolium castaneum glass protein protein. Length = 136 Score = 21.0 bits (42), Expect = 8.1 Identities = 12/32 (37%), Positives = 14/32 (43%) Frame = +3 Query: 225 SWEKTL*CAKHQRPPGQQSSPRETVATHQGQR 320 S EK C R Q SS + TH G+R Sbjct: 45 SGEKPFRCPVCDRRFSQSSSVTTHMRTHSGER 76 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 156,358 Number of Sequences: 336 Number of extensions: 3502 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15457268 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -