BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20918 (690 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 25 0.44 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 1.8 AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 ... 23 3.1 AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless prot... 21 9.5 AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholo... 21 9.5 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 25.4 bits (53), Expect = 0.44 Identities = 13/36 (36%), Positives = 19/36 (52%), Gaps = 3/36 (8%) Frame = +2 Query: 479 HRVRYGHPPHSKIREE---YPDRIMNTYSVVPSPKV 577 H RYGH P+ + EE PD I++ + PK+ Sbjct: 305 HLRRYGHTPNVVLDEEGNPCPDIIIDVHGTRRGPKI 340 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 23.4 bits (48), Expect = 1.8 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = +1 Query: 94 NQIGAKFWEIISDEHGIDPTGAYHGDSDLQLERINVYYNEA 216 N+I + W + D G AYHGD + E I ++A Sbjct: 911 NRIRNQRWIVNRDTSGATGPFAYHGDQWVGFEDIKSVRDKA 951 Score = 21.0 bits (42), Expect = 9.5 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +3 Query: 639 QTKPTASTTRLYTTSAS 689 QTK T STT TT+ S Sbjct: 1184 QTKTTTSTTTRPTTTVS 1200 >AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q4 protein. Length = 491 Score = 22.6 bits (46), Expect = 3.1 Identities = 12/32 (37%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Frame = +2 Query: 437 LPTGLPTYTFPRWRHRVRYGHPP-HSKIREEY 529 L TGL T P+W++R + P H I +E+ Sbjct: 111 LGTGLLTSAGPKWQNRRKILTPAFHFNILQEF 142 >AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless protein. Length = 302 Score = 21.0 bits (42), Expect = 9.5 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = +1 Query: 466 PSVAAPGPVWAPSSF 510 PS+ PGP P+ F Sbjct: 155 PSIIDPGPALPPAGF 169 >AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholog protein. Length = 406 Score = 21.0 bits (42), Expect = 9.5 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = +1 Query: 466 PSVAAPGPVWAPSSF 510 PS+ PGP P+ F Sbjct: 155 PSIIDPGPALPPTGF 169 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 155,826 Number of Sequences: 336 Number of extensions: 3405 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18114270 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -