BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20913 (701 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g16030.1 68415.m01838 expressed protein 29 2.3 At2g18610.1 68415.m02167 hypothetical protein 28 6.9 >At2g16030.1 68415.m01838 expressed protein Length = 231 Score = 29.5 bits (63), Expect = 2.3 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -2 Query: 595 KKHSEYIKSDCVHCVPRSARGHLPLPPRSATVW 497 K H+ + +S C S R HLPLP ++A +W Sbjct: 43 KPHTHFPRSTC----DSSPRQHLPLPKKNARIW 71 >At2g18610.1 68415.m02167 hypothetical protein Length = 86 Score = 27.9 bits (59), Expect = 6.9 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = -3 Query: 537 GVICRSHRGLRRSGDGLVTV*RRSSDGLATVWRRSSDGLAARWPSV 400 GV CR H G R GL + DG R D A PSV Sbjct: 31 GVACRDHSGFRLEKLGLFCWWKLQKDGCGQKLNRRKDHRAFPLPSV 76 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,462,972 Number of Sequences: 28952 Number of extensions: 266353 Number of successful extensions: 550 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 529 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 550 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1506636208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -