BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20911 (659 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF025669-1|AAB81523.1| 243|Tribolium castaneum GABA receptor su... 25 0.73 EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglu... 21 9.0 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 21 9.0 AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory recept... 21 9.0 AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 21 9.0 >AF025669-1|AAB81523.1| 243|Tribolium castaneum GABA receptor subunit protein. Length = 243 Score = 24.6 bits (51), Expect = 0.73 Identities = 10/31 (32%), Positives = 14/31 (45%) Frame = -3 Query: 657 FSQRKYQYFLVITKSTSIYRIHYIGILFNDI 565 F K YF + T S R+H+ G + I Sbjct: 129 FVNEKQSYFHIATTSNEFIRVHHSGSITRSI 159 >EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglucosaminidase NAG3 protein. Length = 582 Score = 21.0 bits (42), Expect = 9.0 Identities = 6/14 (42%), Positives = 10/14 (71%) Frame = +2 Query: 353 QLLLCGSSEEFRGH 394 + ++CG S+ F GH Sbjct: 324 KFVICGESDIFNGH 337 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 21.0 bits (42), Expect = 9.0 Identities = 10/34 (29%), Positives = 15/34 (44%) Frame = -3 Query: 462 KQMEQIVKLKCSIMLRLMEPRQACPRNSSEDPHS 361 K E + L + + +M P P+N D HS Sbjct: 627 KVKENEITLLVATVRHVMAPSTCQPQNPDNDVHS 660 >AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory receptor candidate 41 protein. Length = 398 Score = 21.0 bits (42), Expect = 9.0 Identities = 11/48 (22%), Positives = 21/48 (43%) Frame = -1 Query: 602 IAYII*VYCLMT*FLMLTKITLAYFKSIFFSCVILTLCVHNARESNQN 459 + Y++ +Y L + M+TK+ + F I + + A S N Sbjct: 268 VVYVLILYILESLLYMVTKLVVVTFLKFIKKIQIFGIMITKACMSASN 315 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 21.0 bits (42), Expect = 9.0 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = -2 Query: 469 PIKTDGTNCKAKVLN 425 P T+GTNC+ +N Sbjct: 404 PSGTNGTNCEIDTIN 418 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 139,541 Number of Sequences: 336 Number of extensions: 2715 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17073220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -