BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20911 (659 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_2066| Best HMM Match : Dynein_heavy (HMM E-Value=0) 30 1.5 SB_54465| Best HMM Match : PufQ (HMM E-Value=1.6) 29 3.4 SB_42669| Best HMM Match : Sorb (HMM E-Value=9.2) 29 4.4 SB_35522| Best HMM Match : AT_hook (HMM E-Value=7.3) 29 4.4 SB_35509| Best HMM Match : Sorb (HMM E-Value=9.2) 29 4.4 SB_33398| Best HMM Match : Sorb (HMM E-Value=9.9) 29 4.4 SB_33087| Best HMM Match : Fascin (HMM E-Value=8.9) 29 4.4 SB_30852| Best HMM Match : RVT_1 (HMM E-Value=0) 29 4.4 SB_27867| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_26585| Best HMM Match : RVT_1 (HMM E-Value=0) 29 4.4 SB_26303| Best HMM Match : Fascin (HMM E-Value=4.4) 29 4.4 SB_22717| Best HMM Match : RuvA_C (HMM E-Value=7) 29 4.4 SB_13686| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_9025| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_6247| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_3473| Best HMM Match : Fascin (HMM E-Value=4.4) 29 4.4 SB_42310| Best HMM Match : RVT_1 (HMM E-Value=0) 29 4.4 SB_36813| Best HMM Match : RVT_1 (HMM E-Value=1.4e-14) 29 4.4 SB_31875| Best HMM Match : SNF2_N (HMM E-Value=0) 29 4.4 SB_30215| Best HMM Match : RVT_1 (HMM E-Value=2.6e-34) 29 4.4 SB_14841| Best HMM Match : RVT_1 (HMM E-Value=0) 29 4.4 SB_14288| Best HMM Match : Sorb (HMM E-Value=9.9) 29 4.4 SB_10495| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_10251| Best HMM Match : RVT_1 (HMM E-Value=0.0022) 29 4.4 SB_9596| Best HMM Match : BAF (HMM E-Value=1.54143e-44) 29 4.4 SB_8605| Best HMM Match : RVT_1 (HMM E-Value=0) 29 4.4 SB_7670| Best HMM Match : Sorb (HMM E-Value=9.2) 29 4.4 SB_3943| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_63| Best HMM Match : RVT_1 (HMM E-Value=0) 29 4.4 SB_57323| Best HMM Match : ShTK (HMM E-Value=0) 28 5.9 SB_42739| Best HMM Match : 7tm_1 (HMM E-Value=3.9e-21) 28 5.9 SB_26778| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.9 SB_54863| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.7 SB_40960| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.7 SB_17592| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.7 >SB_2066| Best HMM Match : Dynein_heavy (HMM E-Value=0) Length = 1256 Score = 30.3 bits (65), Expect = 1.5 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = +2 Query: 338 ISVDLQLLLCGSSEEFRGHACRGSINLSIIEHFSFTIC 451 ++ D ++ + G+ EEFR A RGSI +I S+ C Sbjct: 439 VAADTEIKINGAREEFRPVATRGSILYFLIVEMSYVNC 476 >SB_54465| Best HMM Match : PufQ (HMM E-Value=1.6) Length = 379 Score = 29.1 bits (62), Expect = 3.4 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -3 Query: 345 TDILHKSWRTGTCSPFCDIRSREMKDY 265 T I+ K+WR CSPF + + +K Y Sbjct: 90 TSIVGKTWRVHCCSPFHKLCYKNLKQY 116 >SB_42669| Best HMM Match : Sorb (HMM E-Value=9.2) Length = 347 Score = 28.7 bits (61), Expect = 4.4 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = -3 Query: 333 HKSWRTGTCSPFCDIRSREMKDYRSSRIMGL 241 H RT C P I ++E+K + SR++G+ Sbjct: 123 HHKLRTLPCKPSISIDNKELKQVQQSRVLGV 153 >SB_35522| Best HMM Match : AT_hook (HMM E-Value=7.3) Length = 250 Score = 28.7 bits (61), Expect = 4.4 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = -2 Query: 100 NSKCTSKYKSKYFRVHHFNAL 38 N C +YKSK V HFNA+ Sbjct: 167 NDACFDRYKSKLLEVAHFNAV 187 >SB_35509| Best HMM Match : Sorb (HMM E-Value=9.2) Length = 256 Score = 28.7 bits (61), Expect = 4.4 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = -3 Query: 333 HKSWRTGTCSPFCDIRSREMKDYRSSRIMGL 241 H RT C P I ++E+K + SR++G+ Sbjct: 32 HHKLRTLPCKPSISIDNKELKQVQQSRVLGV 62 >SB_33398| Best HMM Match : Sorb (HMM E-Value=9.9) Length = 347 Score = 28.7 bits (61), Expect = 4.4 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = -3 Query: 333 HKSWRTGTCSPFCDIRSREMKDYRSSRIMGL 241 H RT C P I ++E+K + SR++G+ Sbjct: 123 HHKLRTLPCKPSISIDNKELKQVQQSRVLGV 153 >SB_33087| Best HMM Match : Fascin (HMM E-Value=8.9) Length = 347 Score = 28.7 bits (61), Expect = 4.4 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = -3 Query: 333 HKSWRTGTCSPFCDIRSREMKDYRSSRIMGL 241 H RT C P I ++E+K + SR++G+ Sbjct: 123 HHKLRTLPCKPSISIDNKELKQVQQSRVLGV 153 >SB_30852| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 623 Score = 28.7 bits (61), Expect = 4.4 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = -3 Query: 333 HKSWRTGTCSPFCDIRSREMKDYRSSRIMGL 241 H RT C P I ++E+K + SR++G+ Sbjct: 406 HHKLRTLPCKPSISIDNKELKQVQQSRVLGV 436 >SB_27867| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 208 Score = 28.7 bits (61), Expect = 4.4 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = -3 Query: 333 HKSWRTGTCSPFCDIRSREMKDYRSSRIMGL 241 H RT C P I ++E+K + SR++G+ Sbjct: 123 HHKLRTLPCKPSISIDNKELKQVQQSRVLGV 153 >SB_26585| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 317 Score = 28.7 bits (61), Expect = 4.4 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = -3 Query: 333 HKSWRTGTCSPFCDIRSREMKDYRSSRIMGL 241 H RT C P I ++E+K + SR++G+ Sbjct: 232 HHKLRTLPCKPSISIDNKELKQVQQSRVLGV 262 >SB_26303| Best HMM Match : Fascin (HMM E-Value=4.4) Length = 328 Score = 28.7 bits (61), Expect = 4.4 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = -3 Query: 333 HKSWRTGTCSPFCDIRSREMKDYRSSRIMGL 241 H RT C P I ++E+K + SR++G+ Sbjct: 123 HHKLRTLPCKPSISIDNKELKQVQQSRVLGV 153 >SB_22717| Best HMM Match : RuvA_C (HMM E-Value=7) Length = 256 Score = 28.7 bits (61), Expect = 4.4 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = -3 Query: 333 HKSWRTGTCSPFCDIRSREMKDYRSSRIMGL 241 H RT C P I ++E+K + SR++G+ Sbjct: 32 HHKLRTLPCKPSISIDNKELKQVQQSRVLGV 62 >SB_13686| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 208 Score = 28.7 bits (61), Expect = 4.4 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = -3 Query: 333 HKSWRTGTCSPFCDIRSREMKDYRSSRIMGL 241 H RT C P I ++E+K + SR++G+ Sbjct: 123 HHKLRTLPCKPSISIDNKELKQVQQSRVLGV 153 >SB_9025| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 278 Score = 28.7 bits (61), Expect = 4.4 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = -3 Query: 333 HKSWRTGTCSPFCDIRSREMKDYRSSRIMGL 241 H RT C P I ++E+K + SR++G+ Sbjct: 54 HHKLRTLPCKPSISIDNKELKQVQQSRVLGV 84 >SB_6247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 917 Score = 28.7 bits (61), Expect = 4.4 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = -3 Query: 333 HKSWRTGTCSPFCDIRSREMKDYRSSRIMGL 241 H RT C P I ++E+K + SR++G+ Sbjct: 650 HHKLRTLPCKPSISIDNKELKQVQQSRVLGV 680 >SB_3473| Best HMM Match : Fascin (HMM E-Value=4.4) Length = 208 Score = 28.7 bits (61), Expect = 4.4 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = -3 Query: 333 HKSWRTGTCSPFCDIRSREMKDYRSSRIMGL 241 H RT C P I ++E+K + SR++G+ Sbjct: 123 HHKLRTLPCKPSISIDNKELKQVQQSRVLGV 153 >SB_42310| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 940 Score = 28.7 bits (61), Expect = 4.4 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = -3 Query: 333 HKSWRTGTCSPFCDIRSREMKDYRSSRIMGL 241 H RT C P I ++E+K + SR++G+ Sbjct: 716 HHKLRTLPCKPSISIDNKELKQVQQSRVLGV 746 >SB_36813| Best HMM Match : RVT_1 (HMM E-Value=1.4e-14) Length = 382 Score = 28.7 bits (61), Expect = 4.4 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = -3 Query: 333 HKSWRTGTCSPFCDIRSREMKDYRSSRIMGL 241 H RT C P I ++E+K + SR++G+ Sbjct: 193 HHKLRTLPCKPSISIDNKELKQVQQSRVLGV 223 >SB_31875| Best HMM Match : SNF2_N (HMM E-Value=0) Length = 1478 Score = 28.7 bits (61), Expect = 4.4 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = -3 Query: 333 HKSWRTGTCSPFCDIRSREMKDYRSSRIMGL 241 H RT C P I ++E+K + SR++G+ Sbjct: 151 HHKLRTLPCKPSISIDNKELKQVQQSRVLGV 181 >SB_30215| Best HMM Match : RVT_1 (HMM E-Value=2.6e-34) Length = 875 Score = 28.7 bits (61), Expect = 4.4 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = -3 Query: 333 HKSWRTGTCSPFCDIRSREMKDYRSSRIMGL 241 H RT C P I ++E+K + SR++G+ Sbjct: 651 HHKLRTLPCKPSISIDNKELKQVQQSRVLGV 681 >SB_14841| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1821 Score = 28.7 bits (61), Expect = 4.4 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = -3 Query: 333 HKSWRTGTCSPFCDIRSREMKDYRSSRIMGL 241 H RT C P I ++E+K + SR++G+ Sbjct: 1597 HHKLRTLPCKPSISIDNKELKQVQQSRVLGV 1627 >SB_14288| Best HMM Match : Sorb (HMM E-Value=9.9) Length = 347 Score = 28.7 bits (61), Expect = 4.4 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = -3 Query: 333 HKSWRTGTCSPFCDIRSREMKDYRSSRIMGL 241 H RT C P I ++E+K + SR++G+ Sbjct: 123 HHKLRTLPCKPSISIDNKELKQVQQSRVLGV 153 >SB_10495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 258 Score = 28.7 bits (61), Expect = 4.4 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = -3 Query: 333 HKSWRTGTCSPFCDIRSREMKDYRSSRIMGL 241 H RT C P I ++E+K + SR++G+ Sbjct: 123 HHKLRTLPCKPSISIDNKELKQVQQSRVLGV 153 >SB_10251| Best HMM Match : RVT_1 (HMM E-Value=0.0022) Length = 717 Score = 28.7 bits (61), Expect = 4.4 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = -3 Query: 333 HKSWRTGTCSPFCDIRSREMKDYRSSRIMGL 241 H RT C P I ++E+K + SR++G+ Sbjct: 596 HHKLRTLPCKPSISIDNKELKQVQQSRVLGV 626 >SB_9596| Best HMM Match : BAF (HMM E-Value=1.54143e-44) Length = 759 Score = 28.7 bits (61), Expect = 4.4 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = -3 Query: 333 HKSWRTGTCSPFCDIRSREMKDYRSSRIMGL 241 H RT C P I ++E+K + SR++G+ Sbjct: 542 HHKLRTLPCKPSISIDNKELKQVQQSRVLGV 572 >SB_8605| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 284 Score = 28.7 bits (61), Expect = 4.4 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = -3 Query: 333 HKSWRTGTCSPFCDIRSREMKDYRSSRIMGL 241 H RT C P I ++E+K + SR++G+ Sbjct: 232 HHKLRTLPCKPSISIDNKELKQVQQSRVLGV 262 >SB_7670| Best HMM Match : Sorb (HMM E-Value=9.2) Length = 215 Score = 28.7 bits (61), Expect = 4.4 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = -3 Query: 333 HKSWRTGTCSPFCDIRSREMKDYRSSRIMGL 241 H RT C P I ++E+K + SR++G+ Sbjct: 32 HHKLRTLPCKPSISIDNKELKQVQQSRVLGV 62 >SB_3943| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1457 Score = 28.7 bits (61), Expect = 4.4 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = -3 Query: 333 HKSWRTGTCSPFCDIRSREMKDYRSSRIMGL 241 H RT C P I ++E+K + SR++G+ Sbjct: 913 HHKLRTLPCKPSISIDNKELKQVQQSRVLGV 943 >SB_63| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 680 Score = 28.7 bits (61), Expect = 4.4 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = -3 Query: 333 HKSWRTGTCSPFCDIRSREMKDYRSSRIMGL 241 H RT C P I ++E+K + SR++G+ Sbjct: 456 HHKLRTLPCKPSISIDNKELKQVQQSRVLGV 486 >SB_57323| Best HMM Match : ShTK (HMM E-Value=0) Length = 911 Score = 28.3 bits (60), Expect = 5.9 Identities = 11/38 (28%), Positives = 19/38 (50%), Gaps = 4/38 (10%) Frame = +3 Query: 258 CCDNPSFHGYGCRKT----DCKFLYANSCEEYQLISNC 359 C +NP + C KT DC + +C+++Q + C Sbjct: 611 CTNNPQWMNDNCAKTCGACDCMDNFPQACQDWQKVGEC 648 >SB_42739| Best HMM Match : 7tm_1 (HMM E-Value=3.9e-21) Length = 683 Score = 28.3 bits (60), Expect = 5.9 Identities = 17/62 (27%), Positives = 29/62 (46%), Gaps = 1/62 (1%) Frame = -3 Query: 642 YQYFLVITKSTSIYRIHYIGILFNDIVFNVNQNYFSLL*KYIFLL-CYLNFMRSQCTGIQ 466 Y L+ Y++ Y + + D+V YF++ +YIFL+ C + + C G Sbjct: 316 YAIILIFVVCYIPYQVFYF-LEYFDVVSYQKWRYFTVCRRYIFLITCLPSALHPLCYGTM 374 Query: 465 SK 460 SK Sbjct: 375 SK 376 >SB_26778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1050 Score = 28.3 bits (60), Expect = 5.9 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = -3 Query: 387 RNSSEDPHSSSWRSTDILHKSWRTGTCSPFC 295 RN S +S + T + HK W C+ FC Sbjct: 548 RNDSLGHYSCNANGTKVCHKDWYGDLCTTFC 578 >SB_54863| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1251 Score = 27.9 bits (59), Expect = 7.7 Identities = 12/39 (30%), Positives = 18/39 (46%) Frame = +1 Query: 208 DSSVYSYCSRKQAHDSAAAIILHFTATDVAKRTASSCTP 324 DS +SYC R H++ I+ A D + T + P Sbjct: 914 DSEYFSYCIRNYIHENPDLILWELAANDYHRYTDRNMDP 952 >SB_40960| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 27.9 bits (59), Expect = 7.7 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = +1 Query: 169 PARPGAHPGCPLCDSSVYSYCSRKQAHDSAA 261 P R G P CP +S Y Y + +Q D+ A Sbjct: 78 PRRLGKDPDCPCSESREYHYQASEQQGDTGA 108 >SB_17592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3592 Score = 27.9 bits (59), Expect = 7.7 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = -2 Query: 253 NHGLVYANSNYTLTSHIAGNR 191 NH YAN NY HI NR Sbjct: 3307 NHNYPYANHNYPFAHHICPNR 3327 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,771,205 Number of Sequences: 59808 Number of extensions: 325595 Number of successful extensions: 1013 Number of sequences better than 10.0: 35 Number of HSP's better than 10.0 without gapping: 901 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1013 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1693527500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -