BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20906 (649 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 23 1.6 AM292355-1|CAL23167.1| 324|Tribolium castaneum gustatory recept... 22 5.0 U63132-1|AAB38392.1| 372|Tribolium castaneum decapentaplegic pr... 21 6.6 >U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse transcriptase andRNase H protein. Length = 712 Score = 23.4 bits (48), Expect = 1.6 Identities = 7/24 (29%), Positives = 16/24 (66%) Frame = -1 Query: 334 LDFENIQVLYQHESKHQDVPSKQS 263 +DF+N ++L ++ KH P +++ Sbjct: 192 IDFDNNEILLRNGEKHHSFPFRKT 215 >AM292355-1|CAL23167.1| 324|Tribolium castaneum gustatory receptor candidate 34 protein. Length = 324 Score = 21.8 bits (44), Expect = 5.0 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = -2 Query: 345 IFSFLILRIFKYCINTSPSIRMFLQSSQYIR 253 I+SFL+L + S R +L+S YI+ Sbjct: 25 IYSFLLLTTLTLLVILSSIDRPYLKSYTYIK 55 >U63132-1|AAB38392.1| 372|Tribolium castaneum decapentaplegic protein protein. Length = 372 Score = 21.4 bits (43), Expect = 6.6 Identities = 5/11 (45%), Positives = 8/11 (72%) Frame = +1 Query: 211 WLFIFCCWGST 243 +L + CCWG + Sbjct: 8 YLIVACCWGKS 18 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 149,892 Number of Sequences: 336 Number of extensions: 3300 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16656800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -