BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20906 (649 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-13|CAJ14164.1| 420|Anopheles gambiae predicted protein... 25 1.6 AY428512-1|AAR89530.1| 420|Anopheles gambiae EKN1 protein. 25 1.6 AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P... 25 2.1 AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 23 8.3 AJ438610-11|CAD27483.1| 765|Anopheles gambiae hypothetical prot... 23 8.3 >CR954257-13|CAJ14164.1| 420|Anopheles gambiae predicted protein protein. Length = 420 Score = 25.4 bits (53), Expect = 1.6 Identities = 10/34 (29%), Positives = 21/34 (61%) Frame = +3 Query: 540 PHNWETFISDIVGASKTNESLCXNNMEIFKLLSE 641 PH WE F++ + A ++ S+ N + +F+L+ + Sbjct: 57 PHYWELFLAHPIDADASHCSILENEV-VFELVKQ 89 >AY428512-1|AAR89530.1| 420|Anopheles gambiae EKN1 protein. Length = 420 Score = 25.4 bits (53), Expect = 1.6 Identities = 10/34 (29%), Positives = 21/34 (61%) Frame = +3 Query: 540 PHNWETFISDIVGASKTNESLCXNNMEIFKLLSE 641 PH WE F++ + A ++ S+ N + +F+L+ + Sbjct: 57 PHYWELFLAHPIDADASHCSILENEV-VFELVKQ 89 >AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P450 reductase protein. Length = 679 Score = 25.0 bits (52), Expect = 2.1 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +1 Query: 319 YSQNQETKYYALQILEQVILTRWKILPRNQ 408 +S++QE K Y +LEQ W ++ N+ Sbjct: 596 FSRDQEKKVYVTHLLEQDSDLIWSVIGENK 625 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 23.0 bits (47), Expect = 8.3 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +1 Query: 292 WTRVDTILEYSQNQETKYY 348 W+ +DT ++ Q+ TKY+ Sbjct: 17 WSDLDTFVQIKQHYTTKYH 35 >AJ438610-11|CAD27483.1| 765|Anopheles gambiae hypothetical protein protein. Length = 765 Score = 23.0 bits (47), Expect = 8.3 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +1 Query: 292 WTRVDTILEYSQNQETKYY 348 W+ +DT ++ Q+ TKY+ Sbjct: 17 WSDLDTFVQIKQHYTTKYH 35 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 641,588 Number of Sequences: 2352 Number of extensions: 12656 Number of successful extensions: 17 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 63977715 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -