BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20891 (572 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF487537-1|AAL93298.1| 507|Anopheles gambiae cytochrome P450 CY... 27 0.43 EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calc... 23 9.3 EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 23 9.3 >AF487537-1|AAL93298.1| 507|Anopheles gambiae cytochrome P450 CYP6P2 protein. Length = 507 Score = 27.1 bits (57), Expect = 0.43 Identities = 18/66 (27%), Positives = 26/66 (39%), Gaps = 1/66 (1%) Frame = +2 Query: 44 MAQQEISCGYEYIITADLQTCLTEALQCSYSFIVSPIIHPRFRRQSTNA-GKNGGFTRSD 220 M E++ A +T T C Y P I R RR+ A +NGG D Sbjct: 297 MTMNELAAQVFIFFLAGFETSSTTMNFCLYELAKHPDIQERLRREIERAVEENGGELTYD 356 Query: 221 MVLSPQ 238 +V+ + Sbjct: 357 VVMGTE 362 >EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calcium channel alpha2-delta subunit 1 protein. Length = 1256 Score = 22.6 bits (46), Expect = 9.3 Identities = 9/18 (50%), Positives = 13/18 (72%), Gaps = 1/18 (5%) Frame = +1 Query: 283 VDSPSATVRQRHED-YLN 333 VD+PS T+ +RH+ Y N Sbjct: 582 VDNPSNTINERHDQRYAN 599 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 22.6 bits (46), Expect = 9.3 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -1 Query: 545 GLIPSFLFFIIFMHSLYVLLH 483 G+I S F I+F+ Y+LL+ Sbjct: 688 GIIASIYFIILFICGNYILLN 708 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 636,942 Number of Sequences: 2352 Number of extensions: 13436 Number of successful extensions: 15 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 54245403 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -